Property Summary

Ligand Count 1
NCBI Gene PubMed Count 54
PubMed Score 157.41
PubTator Score 74.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Nerve Sheath Neoplasms 5 0.0 0.0
Neurilemmoma 23 0.0 0.0
Disease Target Count
Nerve Sheath Tumors 5
Disease Target Count Z-score Confidence
Weaver syndrome 7 4.397 2.2

Expression

Protein-protein Interaction (2)

PDB (36)

Gene RIF (29)

AA Sequence

MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK      1 - 70
GKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD     71 - 140
ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVS    141 - 210
KDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY    211 - 280
NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNV    281 - 350
TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR    351 - 420
DSSILIAVCDDASIWRWDRLR                                                     421 - 441
//

Text Mined References (76)

PMID Year Title