Property Summary

NCBI Gene PubMed Count 55
PubMed Score 155.88
PubTator Score 150.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.100 3.7e-02
psoriasis -3.500 4.3e-06
osteosarcoma 1.933 1.2e-03
posterior fossa group A ependymoma 1.300 2.4e-08
periodontitis -1.300 2.5e-29
glioblastoma 1.500 9.7e-05
medulloblastoma, large-cell -1.300 8.8e-04
hereditary spastic paraplegia -1.119 5.0e-02
juvenile dermatomyositis 1.156 1.3e-06
Amyotrophic Lateral Sclerosis 1.184 3.8e-05
acute quadriplegic myopathy 1.002 5.9e-03
lung cancer -1.300 3.6e-02
pediatric high grade glioma 1.200 8.7e-06
invasive ductal carcinoma -1.200 3.2e-03
ovarian cancer -1.200 5.6e-04
Gaucher disease type 3 -1.500 1.8e-03
head and neck cancer -1.200 3.5e-02
head and neck cancer and chronic obstruc... -1.100 5.3e-03

Gene RIF (23)

PMID Text
26993163 EEA1 mobility on endosomes is decreased upon stimulation of EGF receptor endocytosis in HeLa cells
25998683 Under the regulation of Rab5, the fused vesicles are targeted to early endosomes and thus deliver the internalized TbetaRI to the caveolin-1 and EEA1 double-positive early endosomes (caveolin-1-positive early endosomes).
25711083 In serum-deprivated HeLa cells with low endocytic activity there two types of EEA1-vesicles: the first one carries the both EEA1 and Rab5 at high levels; the second consists of weakly decorated EEA1-vesicles that can be both Rab5-positive and -negative.
24644286 Data indicate that early endosome antigen 1 (EEA1) is important for the small GTPase Rab31-mediated enhancement of ligand-bound EGF receptor (EGFR) endocytic trafficking.
24491918 nuclear uptake of Abeta involves the dynamin-dependent EEA1 and TGF-beta/Smad signaling pathways.
24086611 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23874603 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23729440 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23499280 We therefore propose that the N1072K variant of the EEA1 gene is a candidate mutation for susceptibility to diabetes in the Japanese population.
22915584 NMR analyses of the interaction between the FYVE domain of early endosome antigen 1 (EEA1) and phosphoinositide embedded in a lipid bilayer.
22816767 EEA1 interacts with Phafin2 and colocolizes with Phafin2 in endosome membrane.
21789505 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
21556036 p97 inhibition causes increased EEA1 self-association at the endosome membrane.
21468601 The knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via the attenuated phosphorylation of Akt, independent of the effects of EEA1.
20534488 crystal structure of Rab5A in complex with the EEA1 C(2)H(2) zinc finger
18305041 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
17146146 results suggest that the local production of PtdIns(3)P implicates the fusion of macropinosomes via EEA1 as well as conventional early endosomes
17113235 Impairment of internalization of specific glutamate receptors and their subsequent accumulation in the synapse may account for the neurological deficits observed in some patients developing EEA1 autoantibodies.
16448788 PIKfyve is distributed in microdomains that are distinct from those occupied by EEA1 and Hrs
16331966 Results describe the geometry of the micelle penetration of the early endosome antigen 1 FYVE domain.
15451443 These results suggest that EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
15052657 macropinosomes do not mature to late endosomes or fuse with lysosomes. EEA1 continuously mediates homotypic fusion as long as the macropinosomes persist.
12963735 activation of p38 MAPK caused a decrease in EEA1 colocalization with phagosomes, arresting maturation into the phagolysosome

AA Sequence

MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDS      1 - 70
GHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSL     71 - 140
EQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDL    141 - 210
KTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGP    211 - 280
QEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQ    281 - 350
SRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH    351 - 420
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQH    421 - 490
QEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGET    491 - 560
AVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQL    561 - 630
NESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDK    631 - 700
QEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATEL    701 - 770
SKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTE    771 - 840
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLK    841 - 910
EQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQG    911 - 980
ELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLK    981 - 1050
SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELV   1051 - 1120
NEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEK   1121 - 1190
RNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS   1191 - 1260
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQEL   1261 - 1330
GRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVR   1331 - 1400
VCDACFNDLQG                                                              1401 - 1411
//

Text Mined References (62)

PMID Year Title
26993163 2016 Mobility of tethering factor EEA1 on endosomes is decreased upon stimulation of EGF receptor endocytosis in HeLa cells.
25998683 2015 Internalization of the TGF-? type I receptor into caveolin-1 and EEA1 double-positive early endosomes.
25711083 2014 [Analysis of vesicle subpopulations carrying early endosomal autoantigen EEA1].
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24644286 2014 Engagement of the small GTPase Rab31 protein and its effector, early endosome antigen 1, is important for trafficking of the ligand-bound epidermal growth factor receptor from the early to the late endosome.
24491918 2014 HIV-1 stimulates nuclear entry of amyloid beta via dynamin dependent EEA1 and TGF-?/Smad signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029230 2013 Haploinsufficiency of SAMD9L, an endosome fusion facilitator, causes myeloid malignancies in mice mimicking human diseases with monosomy 7.
23499280 2013 Exome sequencing identifies a new candidate mutation for susceptibility to diabetes in a family with highly aggregated type 2 diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915584 2012 NMR analyses of the interaction between the FYVE domain of early endosome antigen 1 (EEA1) and phosphoinositide embedded in a lipid bilayer.
22816767 2012 The PtdIns3P-binding protein Phafin 2 mediates epidermal growth factor receptor degradation by promoting endosome fusion.
22719997 2012 SNX12 role in endosome membrane transport.
21556036 2012 The p97 ATPase associates with EEA1 to regulate the size of early endosomes.
21468601 Knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via attenuated phosphorylation of Akt, independent of the effects of EEA1.
21269460 2011 Initial characterization of the human central proteome.
21081650 2010 PI3KC2?, a class II PI3K, is required for dynamin-independent internalization pathways.
20534488 2010 Structural basis for Rab GTPase recognition and endosome tethering by the C2H2 zinc finger of Early Endosomal Autoantigen 1 (EEA1).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19725050 2009 Rab22B is expressed in the CNS astroglia lineage and plays a role in epidermal growth factor receptor trafficking in A431 cells.
19535332 2009 Printor, a novel torsinA-interacting protein implicated in dystonia pathogenesis.
19376974 2009 Roles for endocytic trafficking and phosphatidylinositol 4-kinase III alpha in hepatitis C virus replication.
19296456 2009 Membrane insertion of the FYVE domain is modulated by pH.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18767904 2008 Hrs and SNX3 functions in sorting and membrane invagination within multivesicular bodies.
18388320 2008 Dynamic regulation of ubiquitylation and deubiquitylation at the central spindle during cytokinesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17146146 2006 Effect of 3-methyladenine on the fusion process of macropinosomes in EGF-stimulated A431 cells.
17113235 2006 Human autoantibodies against early endosome antigen-1 enhance excitatory synaptic transmission.
16902405 2006 Membrane targeting and activation of the Lowe syndrome protein OCRL1 by rab GTPases.
16542649 2006 Palmitoyl protein thioesterase 1 (PPT1) deficiency causes endocytic defects connected to abnormal saposin processing.
16541075 2006 The finished DNA sequence of human chromosome 12.
16448788 2006 Cloning and subcellular localization of a human phosphatidylinositol 3-phosphate 5-kinase, PIKfyve/Fab1.
16331966 2005 Investigation of the binding geometry of a peripheral membrane protein.
16314522 2005 Endosomal transport of ErbB-2: mechanism for nuclear entry of the cell surface receptor.
15880641 2005 Transferrin receptor co-localizes and interacts with the hemochromatosis factor (HFE) and the divalent metal transporter-1 (DMT1) in trophoblast cells.
15792797 2005 Regulation of divalent metal transporter expression in human intestinal epithelial cells following exposure to non-haem iron.
15451443 2004 Characterization of early endosome antigen 1 in neural tissues.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15229288 2004 Over-expression of Rififylin, a new RING finger and FYVE-like domain-containing protein, inhibits recycling from the endocytic recycling compartment.
15052657 2004 Association of early endosomal autoantigen 1 with macropinocytosis in EGF-stimulated A431 cells.
14613930 2004 Endofin recruits TOM1 to endosomes.
14600265 2003 Visualization of Rab5 activity in living cells by FRET microscopy and influence of plasma-membrane-targeted Rab5 on clathrin-dependent endocytosis.
12963735 2003 Induction of p38 mitogen-activated protein kinase reduces early endosome autoantigen 1 (EEA1) recruitment to phagosomal membranes.
12536145 2003 Identification of a novel domain in two mammalian inositol-polyphosphate 5-phosphatases that mediates membrane ruffle localization. The inositol 5-phosphatase skip localizes to the endoplasmic reticulum and translocates to membrane ruffles following epidermal growth factor stimulation.
12493736 2003 Determinants of Rab5 interaction with the N terminus of early endosome antigen 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271471 2002 Functional expression of CCR2 by human fetal astrocytes.
11870209 2002 The small GTPase Rab22 interacts with EEA1 and controls endosomal membrane trafficking.
11741531 2001 Multivalent endosome targeting by homodimeric EEA1.
11256955 2001 Characterization of a novel phosphatidylinositol 3-phosphate-binding protein containing two FYVE fingers in tandem that is targeted to the Golgi.
11230696 2001 Structural mechanism of endosome docking by the FYVE domain.
11226253 2001 ARF-GEP(100), a guanine nucleotide-exchange protein for ADP-ribosylation factor 6.
10903204 2000 Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion.
10807926 2000 Interaction of the EEA1 FYVE finger with phosphatidylinositol 3-phosphate and early endosomes. Role of conserved residues.
10506127 1999 The Rab5 effector EEA1 interacts directly with syntaxin-6.
10491193 1999 Direct interaction of EEA1 with Rab5b.
10458612 1999 Oligomeric complexes link Rab5 effectors with NSF and drive membrane fusion via interactions between EEA1 and syntaxin 13.
10394369 1999 Phosphatidylinositol 3-phosphate recognition by the FYVE domain.
10024533 1999 The endosome fusion regulator early-endosomal autoantigen 1 (EEA1) is a dimer.
9697774 1998 EEA1 links PI(3)K function to Rab5 regulation of endosome fusion.
7768953 1995 EEA1, an early endosome-associated protein. EEA1 is a conserved alpha-helical peripheral membrane protein flanked by cysteine "fingers" and contains a calmodulin-binding IQ motif.