Property Summary

NCBI Gene PubMed Count 30
PubMed Score 110.47
PubTator Score 57.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Osteoarthritis 179 0.0 0.0
Disease Target Count
Degenerative polyarthritis 110
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Melanoma 689 0.0 0.5
Disease Target Count Z-score Confidence
Late onset Parkinson disease 1 3.302 1.7
Intermittent claudication 18 3.041 1.5

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease -1.533 4.4e-03
active ulcerative colitis -4.805 3.2e-04
adrenocortical carcinoma -2.048 1.4e-02
adult high grade glioma -2.500 4.4e-04
astrocytoma -1.700 1.4e-09
Atopic dermatitis -1.100 7.1e-04
atypical teratoid / rhabdoid tumor -3.400 9.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.779 1.3e-03
Breast cancer 2.800 2.8e-02
colon cancer -1.600 3.6e-03
cystic fibrosis 1.800 1.5e-02
Down syndrome 1.400 1.6e-03
ependymoma -1.800 1.6e-02
glioblastoma -2.200 6.3e-04
group 4 medulloblastoma 2.400 1.1e-05
head and neck cancer -1.300 2.4e-02
interstitial cystitis -1.100 6.3e-03
invasive ductal carcinoma 2.889 1.0e-03
lung adenocarcinoma -1.100 8.5e-05
lung carcinoma -1.600 6.5e-09
medulloblastoma, large-cell 1.800 1.3e-02
non-small cell lung carcinoma -1.100 9.2e-11
oligodendroglioma -1.100 4.3e-09
osteosarcoma 2.334 7.2e-03
pancreatic cancer 1.500 1.3e-03
Pick disease -1.600 5.4e-03
pituitary cancer 1.200 1.5e-02
primary pancreatic ductal adenocarcinoma 3.321 9.8e-04
progressive supranuclear palsy -2.000 7.4e-03
psoriasis -1.100 1.9e-27
subependymal giant cell astrocytoma -1.518 2.2e-02
uncontrolled asthma -1.200 2.7e-02
urothelial carcinoma 2.800 5.3e-04

Protein-protein Interaction (8)

Gene RIF (19)

AA Sequence

MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE      1 - 70
EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN     71 - 140
YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN    141 - 210
DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP    211 - 280
YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT    281 - 350
WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT    351 - 420
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE              421 - 480
//

Text Mined References (32)

PMID Year Title