Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.39
PubTator Score 6.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Schizophrenia 1136 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 3.0
Vascular disease 294 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.5e-03
glioblastoma 1.100 1.3e-02
non primary Sjogren syndrome sicca 1.300 2.1e-02
osteosarcoma -2.280 1.3e-05

Gene RIF (6)

AA Sequence

MPFRLLIPLGLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPFDELRPLTCDGHDT      1 - 70
WGSFSLTLIDALDTLLILGNVSEFQRVVEVLQDSVDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEV     71 - 140
EAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTG    141 - 210
DPVFEDVARVALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMF    211 - 280
LEYNKAIRNYTRFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLP    281 - 350
EFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK    351 - 420
LDNRMESFFLAETVKYLYLLFDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQR    421 - 490
LKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSPENHDQARERKPAKQKVPLLSCPS    491 - 560
QPFTSKLALLGQVFLDSS                                                        561 - 578
//

Text Mined References (19)

PMID Year Title