Property Summary

NCBI Gene PubMed Count 31
PubMed Score 56.30
PubTator Score 46.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 188 0.0 0.0
Disease Target Count P-value
lung carcinoma 2755 1.2e-14
osteosarcoma 7766 4.6e-04
pancreatic ductal adenocarcinoma liver metastasis 1911 6.1e-04
lung cancer 4607 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5
Disease Target Count Z-score Confidence
Acute cor pulmonale 4 4.051 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.100 1.9e-02
lung carcinoma -1.100 1.2e-14
osteosarcoma -1.331 4.6e-04
pancreatic ductal adenocarcinoma liver m... -2.106 6.1e-04

Protein-protein Interaction (11)

Gene RIF (19)

AA Sequence

MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPVGRPGGVSGPS      1 - 70
WLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSGAFPPQLRAQMRDLARGMFVF     71 - 140
GYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAIMGNSSEFQKAVKLVI    141 - 210
NTVSFDKDSTVQVFEATIRVLGSLLSAHRIITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKT    211 - 280
GIPYPRVNLKTGVPPDTNNETCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNV    281 - 350
VNIQTGHWVGKQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY    351 - 420
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQLQAPDVLFYPL    421 - 490
RPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDKSTEDRMESFFLSETCKYLYL    491 - 560
LFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCN    561 - 630
RVPDERRYSLPLKSIYMRQIDQMVGLI                                               631 - 657
//

Text Mined References (33)

PMID Year Title