Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.25
PubTator Score 7.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 1.3e-07
medulloblastoma, large-cell 6086 1.6e-03
adult high grade glioma 3701 7.2e-03
Disease Target Count Z-score Confidence
Azoospermia 106 3.538 1.8

AA Sequence

MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIY      1 - 70
SLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLR     71 - 140
IIEPISN                                                                   141 - 147
//

Text Mined References (8)

PMID Year Title