Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.29
PubTator Score 19.01

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (14)

PMID Text
26260321 XEDAR activates the non-canonical NF-kappaB pathway.
23959643 To investigate the evolutionary history of the EDA2R/AR intergenic region, we characterized the haplotype structure of 52 of its highly differentiated SNPs. Nearly all human X chromosomes carry one of two modal haplotypes for these 52 SNPs.
22309448 The results suggest that EDA2R confers susceptibility to early onset female pattern hair loss
21724072 association in dental crowding in the Hong Kong Chinese population
20501644 A crucial role of the EDA-A2/ectodysplasin A2 (XEDAR) interaction is revealed in the p53-signaling pathway.
20199557 because no frequent variant other than rs1385699 has been reported in EDA2R in the European population, it is probable that the causative variant(s) modifies the expression of one or more flanking genes, i.e. AR and EDA2R
19590514 Observational study of gene-disease association. (HuGE Navigator)
19543321 XEDAR is a putative tumor suppressor that could prevent malignant transformation and tumor progression by regulating apoptosis and anoikis.
19373488 androgen receptor/ectodysplasin A2 receptor haplotype may have a role in male pattern baldness
18385763 The androgen receptor gene and EDA2R are significantly associated with androgenetic alopecia.
18385763 Observational study of gene-disease association. (HuGE Navigator)
16423472 isoforms of EDA-A5 and A5',activated NF-kappaB through receptors EDAR and XEDAR
15280356 XEDAR belongs to a novel class of death receptors that lack a discernible death domain but are capable of activating apoptosis in a caspase 8- and FADD-dependent fashion
12270937 Results establish a major role of TRAF3 and -6 in X-linked ectodermal dysplasia receptor (XEDAR) signaling and in the process of ectodermal differentiation.

AA Sequence

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRV      1 - 70
QKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEATLV     71 - 140
ALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQ    141 - 210
TQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVE    211 - 280
STGDRLELNVPFEVPSP                                                         281 - 297
//

Text Mined References (23)

PMID Year Title
27144394 2016 Functional Study of Ectodysplasin-A Mutations Causing Non-Syndromic Tooth Agenesis.
26260321 2015 XEDAR activates the non-canonical NF-?B pathway.
23959643 2012 A tale of two haplotypes: the EDA2R/AR Intergenic region is the most divergent genomic segment between Africans and East Asians in the human genome.
22309448 2012 Investigation of the male pattern baldness major genetic susceptibility loci AR/EDA2R and 20p11 in female pattern hair loss.
21724072 2011 Analysis of genetic polymorphisms in skeletal Class I crowding.
20501644 2010 Crosstalk of EDA-A2/XEDAR in the p53 signaling pathway.
20199557 2010 Fine mapping of the human AR/EDA2R locus in androgenetic alopecia.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19543321 2009 XEDAR as a putative colorectal tumor suppressor that mediates p53-regulated anoikis pathway.
19373488 2009 Recent positive selection of a human androgen receptor/ectodysplasin A2 receptor haplotype and its relationship to male pattern baldness.
18385763 2008 EDA2R is associated with androgenetic alopecia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16423472 2006 Repertoire of mouse ectodysplasin-A (EDA-A) isoforms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15280356 2004 Induction of apoptosis by X-linked ectodermal dysplasia receptor via a caspase 8-dependent mechanism.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270937 2002 Role of TRAF3 and -6 in the activation of the NF-kappa B and JNK pathways by X-linked ectodermal dysplasia receptor.
12060722 2002 TRAF6-deficient mice display hypohidrotic ectodermal dysplasia.
11039935 2000 Two-amino acid molecular switch in an epithelial morphogen that regulates binding to two distinct receptors.