Property Summary

NCBI Gene PubMed Count 80
PubMed Score 83.91
PubTator Score 88.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.485 1.1e-02
adrenocortical carcinoma 2.438 4.1e-05
adult high grade glioma 1.200 1.9e-02
Atopic dermatitis 1.500 9.8e-05
atypical teratoid / rhabdoid tumor 1.500 4.6e-04
Breast cancer 3.200 2.5e-02
breast carcinoma 1.600 1.3e-06
colon cancer 2.300 1.5e-02
ductal carcinoma in situ 2.300 1.1e-03
Endometriosis 1.018 4.9e-02
esophageal adenocarcinoma 1.800 2.0e-02
glioblastoma 1.800 6.8e-07
group 3 medulloblastoma 2.200 2.3e-03
intraductal papillary-mucinous adenoma (... 3.000 1.0e-03
intraductal papillary-mucinous carcinoma... 4.000 1.6e-04
intraductal papillary-mucinous neoplasm ... 4.300 1.5e-03
invasive ductal carcinoma 2.300 3.7e-04
lung adenocarcinoma 1.100 1.1e-09
lung cancer 3.500 1.9e-05
medulloblastoma, large-cell 1.500 1.5e-04
nasopharyngeal carcinoma 1.700 3.1e-04
non-small cell lung cancer 3.089 1.8e-30
ovarian cancer 2.300 9.1e-04
pancreatic cancer 2.600 7.5e-08
primitive neuroectodermal tumor 1.500 2.4e-03
psoriasis 1.200 3.5e-03
tuberculosis 1.100 4.6e-03
ulcerative colitis 1.300 1.8e-05

Gene RIF (56)

AA Sequence

MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALK      1 - 70
TIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFND     71 - 140
LYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDF    141 - 210
NSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLG    211 - 280
FSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGET    281 - 350
MYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS    351 - 420
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQVPLEEEGQRGG    421 - 490
PILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSKDLVKTYPPFVNFFEMSKET    491 - 560
IIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGS    561 - 630
LKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDC    631 - 700
LEIARKRHKVIGTFRSPHGQTRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLS    701 - 770
FQMTSDELPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA    771 - 840
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFERRSHTLSRST    841 - 910
THLI                                                                      911 - 914
//

Text Mined References (94)

PMID Year Title