Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.12
PubTator Score 7.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 1.1e-05
glioblastoma -1.100 4.3e-04
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-02
subependymal giant cell astrocytoma -1.068 1.5e-02

Gene RIF (7)

PMID Text
25449573 Authors conclude that ECSIT appears to be a novel Hepatitis B virus X protein-interacting signal molecule and their interaction is mechanistically important in IL-1beta induction of NF-kappaB activation.
25371197 Data show that the ECSIT (evolutionarily conserved signaling intermediate in Toll pathways) complex, including MEKK7 (TAK1) and TNF receptor-associated factor 6 (TRAF6), plays a role in Toll-like receptor 4 -mediated signals to activate NF-kappa B.
25355951 Ubiquitination of ECSIT might have a role in the regulation of NF-kappaB activity in TLR4 signaling.
25228397 mediates virus-triggered type I IFN induction by bridging RIG-I and MDA5 to the VISA complex
22588174 TRIM59 interacts with ECSIT as an adaptor protein required for the TLR-mediated transduction pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17344420 Study shows a mitochondrial function for Ecsit in the assembly of mitochondrial complex I, an N-terminal targeting signal directs Ecsit to mitochondria, where it interacts with assembly chaperone NDUFAF1.

AA Sequence

MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPEPRQRPTKALV      1 - 70
PFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEV     71 - 140
FRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNV    141 - 210
NPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHN    211 - 280
PARPVFVEGPFSLWLRNKCVYYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINE    281 - 350
VEEGPVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEED    351 - 420
DNLQRQQQGQS                                                               421 - 431
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25449573 2015 Hepatitis B virus X protein increases the IL-1?-induced NF-?B activation via interaction with evolutionarily conserved signaling intermediate in Toll pathways (ECSIT).
25371197 2014 TAK1-ECSIT-TRAF6 complex plays a key role in the TLR4 signal to activate NF-?B.
25355951 2015 Ubiquitination of ECSIT is crucial for the activation of p65/p50 NF-?Bs in Toll-like receptor 4 signaling.
25228397 2015 ECSIT bridges RIG-I-like receptors to VISA in signaling events of innate antiviral responses.
22982022 2012 Complexome profiling identifies TMEM126B as a component of the mitochondrial complex I assembly complex.
22588174 2012 TRIM59 interacts with ECSIT and negatively regulates NF-?B and IRF-3/7-mediated signal pathways.
21269460 2011 Initial characterization of the human central proteome.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20816094 2010 Acyl-CoA dehydrogenase 9 is required for the biogenesis of oxidative phosphorylation complex I.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344420 2007 Cytosolic signaling protein Ecsit also localizes to mitochondria where it interacts with chaperone NDUFAF1 and functions in complex I assembly.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633973 2003 Ecsit is required for Bmp signaling and mesoderm formation during mouse embryogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10465784 1999 ECSIT is an evolutionarily conserved intermediate in the Toll/IL-1 signal transduction pathway.