Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.30
PubTator Score 3.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -3.000 1.3e-06
posterior fossa group B ependymoma 5.100 1.9e-21
psoriasis -1.100 1.8e-03
astrocytoma 2.700 4.5e-02
glioblastoma multiforme 1.700 4.1e-15
cystic fibrosis -1.190 5.8e-03
Duchenne muscular dystrophy 1.457 9.8e-07
autosomal dominant Emery-Dreifuss muscul... 1.862 2.3e-03
Atopic dermatitis -1.800 6.3e-04
adrenocortical adenoma -1.196 5.7e-03
non-small cell lung cancer -1.820 4.7e-17
intraductal papillary-mucinous adenoma (... -2.900 9.0e-05
intraductal papillary-mucinous carcinoma... -3.100 4.9e-04
intraductal papillary-mucinous neoplasm ... -2.500 7.1e-03
breast carcinoma -1.700 5.2e-04
fibroadenoma -2.400 2.6e-03
adult high grade glioma 2.300 6.3e-04
pilocytic astrocytoma 1.900 2.9e-04
sonic hedgehog group medulloblastoma 1.400 1.5e-02
lung adenocarcinoma -1.300 6.2e-10
lung carcinoma -1.100 5.3e-06
Pick disease 1.600 1.0e-02
ductal carcinoma in situ -2.600 3.5e-04
invasive ductal carcinoma -3.100 7.0e-05
ovarian cancer -5.100 1.5e-11

AA Sequence

MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIV      1 - 70
NFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHP     71 - 140
QRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGDSSEQREPTNLLHKQLPPPQVGMDRIVRKEA    141 - 210
LQSEEDEEVKEEDTEQKRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGE    211 - 280
EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLEL    281 - 350
TGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELK    351 - 420
VNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIPQGLPGSIEEL    421 - 490
YLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLLH    491 - 560
LVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEM    561 - 630
KALHFLRLNNNKIRNILPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK     631 - 699
//

Text Mined References (12)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9790758 1998 Identification of a novel gene (ECM2) encoding a putative extracellular matrix protein expressed predominantly in adipose and female-specific tissues and its chromosomal localization to 9q22.3.
9345023 1997 Matrix glycoprotein SC1/ECM2 augments B lymphopoiesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.