Property Summary

NCBI Gene PubMed Count 13
PubMed Score 143.23
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.100 2.4e-03
breast carcinoma -1.400 4.9e-04
ductal carcinoma in situ -1.100 1.4e-04
invasive ductal carcinoma -1.600 1.1e-03
lung adenocarcinoma -1.600 5.2e-09
Multiple myeloma 1.022 1.7e-02
ovarian cancer -1.100 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.785 2.6e-03
progressive supranuclear palsy -1.100 1.5e-02

Gene RIF (5)

AA Sequence

MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLN      1 - 70
NPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTL     71 - 140
TRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALK    141 - 210
VLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQ    211 - 280
NERDLLGTVWGGPANLEAIAKKGKFNK                                               281 - 307
//

Text Mined References (18)

PMID Year Title