Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.21
PubTator Score 14.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17676665 HIV-1 gp120 upregulates the expression of enoyl Coenzyme A hydratase 1 in umbilical cord blood mononuclear cells and T-cell lines
16615866 Polymorphism of delta3,5-delta2,4-dienoyl-coenzyme A isomerase (the ECH1 gene product protein) in human striated muscle tissue
7558027 Possible roles for the ECH1 protein product in peroxisomal beta-oxidation are discussed.

AA Sequence

MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHV      1 - 70
QLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISW     71 - 140
YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQ    141 - 210
RLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLL    211 - 280
YSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL                          281 - 328
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16615866 2006 Polymorphism of delta3,5-delta2,4-dienoyl-coenzyme A isomerase (the ECH1 gene product protein) in human striated muscle tissue.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500732 2003 Overexpression of peroxisome proliferator-activated receptor-alpha (PPARalpha)-regulated genes in liver in the absence of peroxisome proliferation in mice deficient in both L- and D-forms of enoyl-CoA hydratase/dehydrogenase enzymes of peroxisomal beta-oxidation system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417087 1998 Delta3,5-delta2,4-dienoyl-CoA isomerase from rat liver. Molecular characterization.
7558027 1995 Isolation and characterization of rat and human cDNAs encoding a novel putative peroxisomal enoyl-CoA hydratase.