Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.23
PubTator Score 23.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.0e-05
lung cancer 4473 1.3e-04
dermatomyositis 966 1.9e-04
diabetes mellitus 1663 1.6e-03
colon cancer 1475 5.3e-03
Breast cancer 3098 2.7e-02
astrocytic glioma 2241 3.3e-02
oligodendroglioma 2849 4.1e-02
Disease Target Count Z-score Confidence
Intracranial hypotension 8 4.262 2.1
Bruxism 19 3.707 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.600 3.3e-02
oligodendroglioma -1.500 4.1e-02
colon cancer 1.200 5.3e-03
lung cancer 1.400 1.3e-04
diabetes mellitus -1.400 1.6e-03
Breast cancer 2.300 2.7e-02
ovarian cancer 2.500 1.0e-05
dermatomyositis 1.200 1.9e-04

 GO Function (1)

Gene RIF (7)

PMID Text
25501510 We further show that the primary tumors as well as metastasized lesions derived from EBV antigen-expressing cancer cells( EBNA3C or EBNA1 ) in nude mice model display EMT markers expression pattern
24481446 EBP2 is a novel binding partner of c-Myc that regulates cell proliferation, and tumorigenesis via a positive feedback loop.
22944692 Positional proteomics analysis identifies the cleavage of human EBNA1 binding protein 2 (EBNA1BP2) at amino acid residues 212-213 by the HIV-1 protease
19170763 BXDC1 and EBNA1BP2 function in a dynamic scaffold for ribosome biogenesis.
18959818 RNA and protein levels of cyclin E1, a dominant oncoprotein, were elevated in the EBP2- enhanced green fluorescent protein stable clones.
15923612 Data show that human EBNA1 binding protein 2 (hEBP2 is essential for the proliferation of human cells and that repression of hEBP2 severely decreases the ability of EBNA1 and EBV-based plasmids to bind mitotic chromosomes.
12768013 attaches to yeast mitotic chromosomes in a cell cycle-dependent manner and causes EBNA1 to attach to the mitotic chromosomes and effect EBV plasmid segregation

AA Sequence

MDTPPLSDSESESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERL      1 - 70
DVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEM     71 - 140
AKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKL    141 - 210
DFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGRG    211 - 280
LKRPGKKGSNKRPGKRTREKMKNRTH                                                281 - 306
//

Text Mined References (31)

PMID Year Title
25501510 2015 Epstein-Barr virus latent antigens EBNA3C and EBNA1 modulate epithelial to mesenchymal transition of cancer cells associated with tumor metastasis.
24481446 2014 A positive feedback loop between EBP2 and c-Myc regulates rDNA transcription, cell proliferation, and tumorigenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19170763 2009 Proteomic and targeted analytical identification of BXDC1 and EBNA1BP2 as dynamic scaffold proteins in the nucleolus.
18959818 2008 Ectopic EBP2 expression enhances cyclin E1 expression and induces chromosome instability in HEK293 stable clones.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
15923612 2005 EBP2 plays a key role in Epstein-Barr virus mitotic segregation and is regulated by aurora family kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12768013 2003 EBNA1 partitions Epstein-Barr virus plasmids in yeast cells by attaching to human EBNA1-binding protein 2 on mitotic chromosomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11438656 2001 NoBP, a nuclear fibroblast growth factor 3 binding protein, is cell cycle regulated and promotes cell growth.
11327720 2001 Expression of p40/Epstein-Barr virus nuclear antigen 1 binding protein 2.
10849420 2000 The budding yeast homolog of the human EBNA1-binding protein 2 (Ebp2p) is an essential nucleolar protein required for pre-rRNA processing.
10074103 1999 EBP2, a human protein that interacts with sequences of the Epstein-Barr virus nuclear antigen 1 important for plasmid maintenance.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
7596406 1995 Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease.
2879624 1987 Identification and partial characterization of a Mr 40,000 nucleolar antigen associated with cell proliferation.