Property Summary

NCBI Gene PubMed Count 43
PubMed Score 5.57
PubTator Score 40.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
psoriasis 6685 4.5e-33
malignant mesothelioma 3163 9.0e-06
osteosarcoma 7933 1.2e-03
interstitial cystitis 2299 3.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 9.0e-06
osteosarcoma -1.092 1.2e-03
interstitial cystitis 1.100 3.2e-02
psoriasis 1.600 4.5e-33

Protein-protein Interaction (2)

Gene RIF (35)

PMID Text
26472010 higher decidual mRNA expression in preeclampsia
26431888 IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML.
26355156 EBI3 Downregulation Contributes to Type I Collagen Overexpression in Scleroderma Skin.
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26204444 Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA.
26116899 HIV-1 Vpr downregulates the expression of EBI3 in human monocyte-derived dendritic cells
26044961 IL-35 can effectively suppress the proliferation and IL-4 production of activated CD4+CD25- T cells in allergic asthma, and that IL-35 may be a new immunotherapy for asthma patients.
25937126 EBI3 gene rs4740 polymorphism is closely associated with susceptibility to pulmonary tuberculosis and the elevation and enrichment of EBI3 in the lung derived from macrophages may contribute to the exacerbation of mycobacterial infection.
25935866 IL-35 mRNA and protein were higher in tuberculous pleural effusions than in malignant ones.
25869609 IL-35 is highly expressed in chronic HBV CD4(+) T-cells and plays an important role in the inhibition of the cellular immune response in chronic HBV.
25640666 IL35 appears to contribute to the loss of immunological self-tolerance in ITP patients by modulating T cells and immunoregulatory cytokines.
25575066 The levels of EBI3 and IL-12p35 mRNAs in peripheral blood mononuclear cells in moderate or hyper-responders were significantly higher than those in non- or hypo-responders.
25323532 IL-17 and IL-35 may be critically involved in the pathogenesis of hepatitis B-related LC.
24994465 IL-35 levels are dramatically decreased in immune thrombocytopenia patients, suggesting that IL-35 may be involved in the pathogenesis of this disease.
24970690 The results suggest that the decreased expression of IL-35 could be involved in the pathogenesis of childhood asthma.
24782489 ingestion of apoptotic cells by DCs leads to increased expression of IL-12p35 and Ebi3 without affecting IL-12p40.
24743305 Interleukin-35 induces regulatory B cells that suppress autoimmune disease. [il-35]
24376289 The increased expression of IL-35 in chronic and aggressive periodontitis suggests its possible role in pathogenesis of periodontitis.
24121041 circulating IL-35 in PDAC patients significantly increased, suggesting that regulating the expression of IL-35 may provide a new possible target for the treatment of PDAC patients, especially for the resectable ones.
23904441 the findings from the past decade identify IL-27 as a critical immunoregulatory cytokine, especially for T cells, whereas some controversy is fueled by results challenging the view of IL-27 as a classical silencer of inflammation.
23898208 HIV-1 Vpr downregulates the expression of EBI3 in human monocyte-derived dendritic cells
23845089 EBI3-overexpression in MRL/lpr mice induces generation of regulatory T cells, causing suppression of autoimmune and inflammatory reactions by affecting the T helper (Th)1 cell/Th2 cytokine balance.
23619469 expressed by trophoblast cells
23562195 The findings of this study suggest that SNPs in FOXP3 and EBI3 genes modify the risk for development of chronic rhinosinusitis.
23154182 these results reveal a novel functional role for IL-35 in suppressing cancer activity, inhibiting cancer cell growth, and increasing the apoptosis sensitivity of human cancer cells through the regulation of genes related to the cell cycle and apoptosis.
22836044 The findings of this study support the potential role of regulatory T cells and genetic variations in the regions around FOXP3 and EBI3 genes in modifying the risk for AR development in Chinese patients.
22438968 in contrast to TGF-beta, IL-35 is not constitutively expressed in tissues but it is inducible in response to inflammatory stimuli
22343630 IL-27 expression is one host immune factor produced in response to influenza A virus infection and that elevated IL-27 levels inhibit viral replication.
21931777 Data show that Epstein-Barr virus-induced gene 3 (EBI3) is differentially expressed among Burkitt lymphoma and diffuse large B-cell lymphoma.
21285006 This study demonstrated that interleukin-35 expression could be detected in the CD4(+) T cells from peripheral blood of chronic hepatitis B patients.
19556516 Our data support a possible role of Ebi3 in atherogenesis
18336908 The genome-wide mRNA expression profile under the condition of short-term stimulation (4h) with IL-18 using the Affymetrix GeneChip((R)) Array System, was characterized.
18167155 findings indicate that the restricted Th1 responses in newborns owing to deficient IL-12 production may be compensated for, in part, by enhanced IL-27 secretion
15170639 results suggest that increased numbers of Epstein-Barr virus-infected cells in areas of active inflammatory bowel disease are secondary to influx or local proliferation of inflammatory cells & do not contribute significantly to local production of EBI3
12121660 a new heterodimeric cytokine that consists of EBI3, an IL-12p40-related protein, and p28, a newly discovered IL-12p35-related polypeptide (IL-27)

AA Sequence

MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGM      1 - 70
AARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPL     71 - 140
AERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTD    141 - 210
YGELSDWSLPATATMSLGK                                                       211 - 229
//

Text Mined References (44)

PMID Year Title
26472010 2016 Higher decidual EBI3 and HLA-G mRNA expression in preeclampsia: Cause or consequence of preeclampsia.
26431888 2015 Elevated IL-35 in bone marrow of the patients with acute myeloid leukemia.
26355156 2015 EBI3 Downregulation Contributes to Type I Collagen Overexpression in Scleroderma Skin.
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26204444 2015 Interleukin 35 Synovial Fluid Levels Are Associated with Disease Activity of Rheumatoid Arthritis.
26044961 2015 A potential immunopathogenic role for reduced IL-35 expression in allergic asthma.
25937126 2015 Epstein-Barr virus-induced gene 3 (EBI3) polymorphisms and expression are associated with susceptibility to pulmonary tuberculosis.
25935866 2015 High IL-35 pleural expression in patients with tuberculous pleural effusion.
25869609 2015 IL-35 inhibits HBV antigen-specific IFN-?-producing CTLs in vitro.
25640666 2015 Interleukin 35 may contribute to the loss of immunological self-tolerance in patients with primary immune thrombocytopenia.
25575066 2015 [IL-35 level of peripheral blood is correlated with the immune response to hepatitis B vaccine].
25323532 2015 Function of interleukin-17 and -35 in the blood of patients with hepatitis B-related liver cirrhosis.
24994465 2014 Decreased IL-35 levels in patients with immune thrombocytopenia.
24970690 2014 The expression of a novel anti-inflammatory cytokine IL-35 and its possible significance in childhood asthma.
24782489 2014 Phagocytosis of apoptotic or necrotic cells differentially regulates the transcriptional expression of IL-12 family members in dendritic cells.
24743305 2014 Interleukin-35 induces regulatory B cells that suppress autoimmune disease.
24376289 2013 Expression profile of IL-35 mRNA in gingiva of chronic periodontitis and aggressive periodontitis patients: a semiquantitative RT-PCR study.
24121041 2014 Circulating IL-35 in pancreatic ductal adenocarcinoma patients.
23904441 2013 Modulation of inflammation by interleukin-27.
23845089 2013 Overexpression of Epstein-Barr virus-induced gene 3 protein (EBI3) in MRL/lpr mice suppresses their lupus nephritis by activating regulatory T cells.
23619469 2013 Human placental trophoblasts express the immunosuppressive cytokine IL-35.
23562195 Some polymorphisms in Epstein-Barr virus-induced gene 3 modify the risk for chronic rhinosinusitis.
23154182 2013 IL-35 over-expression increases apoptosis sensitivity and suppresses cell growth in human cancer cells.
22836044 2012 Association between polymorphisms in FOXP3 and EBI3 genes and the risk for development of allergic rhinitis in Chinese subjects.
22438968 2012 IL-35 is a novel responsive anti-inflammatory cytokine--a new system of categorizing anti-inflammatory cytokines.
22343630 2012 Influenza A virus induces interleukin-27 through cyclooxygenase-2 and protein kinase A signaling.
21931777 2011 Epstein-Barr virus-induced gene 3 (EBI3): a novel diagnosis marker in Burkitt lymphoma and diffuse large B-cell lymphoma.
21285006 2011 Detectable expression of IL-35 in CD4+ T cells from peripheral blood of chronic hepatitis B patients.
19556516 2009 Epstein-barr virus-induced gene-3 is expressed in human atheroma plaques.
18784808 2008 IL27: its roles in the induction and inhibition of inflammation.
18336908 2008 Genome-wide analysis displays marked induction of EBI3/IL-27B in IL-18-activated AML-derived KG1 cells: critical role of two kappaB binding sites in the human EBI3 promotor.
18167155 2008 Enhanced expression of IL-27 mRNA in human newborns.
17294231 2007 The biology and therapeutic potential of interleukin 27.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15170639 2004 Epstein-Barr virus (EBV) infection and expression of the interleukin-12 family member EBV-induced gene 3 (EBI3) in chronic inflammatory bowel disease.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14743498 2004 Expression of IL-27 in human Th1-associated granulomatous diseases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121660 2002 IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells.
9342359 1997 Epstein-Barr virus-induced gene 3 and the p35 subunit of interleukin 12 form a novel heterodimeric hematopoietin.
8551575 1996 A novel interleukin-12 p40-related protein induced by latent Epstein-Barr virus infection in B lymphocytes.
934235 1976 Letter: Statistical analysis of respiratory sensitivity to CO2.