Property Summary

NCBI Gene PubMed Count 18
PubMed Score 135.15
PubTator Score 37.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma -1.100 7.1e-03
ductal carcinoma in situ -1.800 1.4e-03
fibroadenoma -1.100 1.7e-02
group 3 medulloblastoma 5.200 1.3e-06
interstitial cystitis 1.100 5.9e-04
invasive ductal carcinoma -2.100 6.2e-03
lung carcinoma 1.100 4.0e-12
medulloblastoma, large-cell 4.900 5.8e-07
osteosarcoma -3.027 1.1e-03
primitive neuroectodermal tumor 2.200 3.9e-02

Gene RIF (10)

AA Sequence

MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHF      1 - 70
VLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIV     71 - 140
YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRR    141 - 210
FQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGAT    211 - 280
VIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNE    281 - 350
PTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHN    351 - 420
QIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSM    421 - 490
NGYGSGAMASLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNCSSTHGIFSFSPANVISAVKQK    491 - 560
SAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM                                      561 - 596
//

Text Mined References (20)

PMID Year Title