Property Summary

NCBI Gene PubMed Count 16
PubMed Score 96.52
PubTator Score 12.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 1.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.122 1.3e-03
breast carcinoma -1.100 3.4e-11
Duchenne muscular dystrophy 1.052 2.1e-06
ductal carcinoma in situ -1.100 2.4e-03
interstitial cystitis -1.200 3.3e-03
invasive ductal carcinoma -1.700 1.3e-03
juvenile dermatomyositis 1.092 5.5e-10
medulloblastoma 2.200 7.9e-03
medulloblastoma, large-cell 2.400 1.7e-02
ovarian cancer -1.400 2.4e-06
primitive neuroectodermal tumor 2.400 2.6e-03

Gene RIF (7)

AA Sequence

MFGIQDTLGRGPTLKEKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFV      1 - 70
LALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAY     71 - 140
EGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRF    141 - 210
QVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFD    211 - 280
GLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRL    281 - 350
QKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQLPALSSSPA    351 - 420
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANL    421 - 490
GVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGN    491 - 560
GNGFRAMTGLVVPPM                                                           561 - 575
//

Text Mined References (16)

PMID Year Title