Property Summary

NCBI Gene PubMed Count 79
PubMed Score 155.40
PubTator Score 74.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.4e-05
malignant mesothelioma 3232 2.2e-05
psoriasis 6694 7.6e-05
medulloblastoma, large-cell 6241 2.4e-04
Disease Target Count Z-score Confidence
Cancer 2499 3.911 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 2.2e-05
medulloblastoma, large-cell -1.100 2.4e-04
ovarian cancer 1.700 1.4e-05
psoriasis -2.000 7.6e-05

Gene RIF (66)

AA Sequence

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS      1 - 70
VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI     71 - 140
HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV    141 - 210
KLS                                                                       211 - 213
//

Text Mined References (91)

PMID Year Title