Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.54
PubTator Score 17.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ulcerative colitis 2087 5.8e-08
ovarian cancer 8491 3.9e-04
Multiple myeloma 1327 5.5e-04
Disease Target Count Z-score Confidence
farmer's lung 2 3.952 2.0
Holoprosencephaly 52 3.446 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 2.231 5.5e-04
ulcerative colitis -1.400 5.8e-08
ovarian cancer 2.400 3.9e-04

Synonym

Accession Q56P03 Q9BVF4 Q9NWV5 Q9NZ86 EAPP
Symbols BM036
C14orf11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
23542036 Independently of EAPP, E2F1 also increases the activity of the MDR1 promoter.
21258403 results indicate that the level of EAPP is critical for cellular homeostasis
18588995 Regulation of the EAPP promoter by GC-box binding proteins is reported.
15716352 EAPP modulates E2F-regulated transcription, stimulates proliferation, and may be involved in the malignant transformation of cells.

AA Sequence

MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELN      1 - 70
STMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYD     71 - 140
PEKDNRDQAWVDAQRRGYHGLGPQRSRQQQPVPNSDAVLNCPACMTTLCLDCQRHESYKTQYRAMFVMNC    141 - 210
SINKEEVLRYKASENRKKRRVHKKMRSNREDAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNV    211 - 280
LASHS                                                                     281 - 285
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23542036 2013 Regulation of the MDR1 promoter by E2F1 and EAPP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21258403 2011 EAPP: gatekeeper at the crossroad of apoptosis and p21-mediated cell-cycle arrest.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18588995 2008 Regulation of the E2F-associated phosphoprotein promoter by GC-box binding proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15820313 2005 Defining a holoprosencephaly locus on human chromosome 14q13 and characterization of potential candidate genes.
15716352 2005 EAPP, a novel E2F binding protein that modulates E2F-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.