Property Summary

NCBI Gene PubMed Count 22
PubMed Score 95.07
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.596 1.0e-02
malignant mesothelioma -1.200 2.0e-05
oligodendroglioma -1.100 4.2e-02
cutaneous lupus erythematosus 1.900 8.6e-03
osteosarcoma -3.099 7.4e-06
group 3 medulloblastoma -1.500 4.5e-05
periodontitis 1.600 3.8e-24
tuberculosis 1.900 8.7e-06
interstitial cystitis 2.000 9.5e-04
primary Sjogren syndrome 1.400 6.0e-03
ulcerative colitis 2.300 4.6e-06
pituitary cancer -1.600 2.4e-06

Protein-protein Interaction (8)

Gene RIF (12)

PMID Text
26370086 EAF2 binding does not alter Smad3 phosphorylation but causes Smad3 cytoplasmic retention, competes with Smad4 for binding to Smad3, and prevents p300-Smad3 complex formation
25808853 Findings suggest that regulation of the AR signaling pathway, cell proliferation, and migration through FOXA1 represents an important mechanism of EAF2 suppression of prostate carcinogenesis.
24727455 Together these findings identify a novel physical and functional interaction between EAF2 and the Rb pathway.
24421387 EAF2 bound to and suppressed HIF-1alpha.
21483694 the role of the EAF2 in response to simvastatin and lovastatin in HCT-116 colon cancer cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20161747 Findings provide the first convincing line of evidence that EAF and Wnt4 form an auto-regulatory negative feedback loop in vivo.
19826414 Data suggest that U19/EAF2 regulates the expression of TSP-1 via blocking p53 repression of the TSP-1 promoter.
17395368 FB1 is an important binding partner and a functional regulator of U19/EAF2, EAF1, and/or ELL.
16114057 ELL may be an important factor required for U19/Eaf2 function because U19/Eaf2 nuclear localization and transactivation activity are essential for its function as a transcription factor.
16006523 ELL-associated factors 1 and 2 are positive regulators of RNA polymerase II elongation factor ELL.
12907652 U19 is growth inhibitory and tumor suppressive and that the disruption of androgen-dependent growth inhibition via U19 down-regulation is commonly associated with prostate cancer progression.

AA Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST      1 - 70
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL     71 - 140
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG    141 - 210
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD                        211 - 260
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26370086 2015 ELL Protein-associated Factor 2 (EAF2) Inhibits Transforming Growth Factor ? Signaling through a Direct Interaction with Smad3.
25808853 2015 FOXA1 modulates EAF2 regulation of AR transcriptional activity, cell proliferation, and migration in prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24727455 2014 Identification of a genetic interaction between the tumor suppressor EAF2 and the retinoblastoma protein (Rb) signaling pathway in C. elegans and prostate cancer cells.
24421387 2014 EAF2 suppresses hypoxia-induced factor 1? transcriptional activity by disrupting its interaction with coactivator CBP/p300.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21483694 2011 NCI60 cancer cell line panel data and RNAi analysis help identify EAF2 as a modulator of simvastatin and lovastatin response in HCT-116 cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20161747 2010 Negative feedback regulation of Wnt4 signaling by EAF1 and EAF2/U19.
19826414 2010 Tumor suppressor U19/EAF2 regulates thrombospondin-1 expression via p53.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17395368 2007 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity.
16114057 2006 ELL binding regulates U19/Eaf2 intracellular localization, stability, and transactivation.
16006523 2005 ELL-associated factors 1 and 2 are positive regulators of RNA polymerase II elongation factor ELL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12907652 2003 Suppression of prostate tumor growth by U19, a novel testosterone-regulated apoptosis inducer.
12761297 2003 Identification of a novel tissue-specific transcriptional activator FESTA as a protein that interacts with the transcription elongation factor S-II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446457 2003 ELL-associated factor 2 (EAF2), a functional homolog of EAF1 with alternative ELL binding properties.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.