Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession E9PRG8
Symbols C11orf48

Gene

 Compartment GO Term (0)

AA Sequence

MGAPGGKINRPRTELKKKLFKRRRVLNRERRLRHRVVGAVIDQGLITRHHLKKRASSARANITLSGKKRR      1 - 70
KLLQQIRLAQKEKTAMEGEAGTEVGEGNPGFIWDNTSFFPLLSGSPFKASQD                       71 - 122
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.