Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MGAPGGKINRPRTELKKKLFKRRRVLNRERRLRHRVVGAVIDQGLITRHHLKKRASSARANITLSGKKRR      1 - 70
KLLQQIRLAQKEKTAMEGEAGTEVGEGNPGFIWDNTSFFPLLSGSPFKASQD                       71 - 122
//

Text Mined References (5)

PMID Year Title