Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.7e-09
psoriasis 6694 8.0e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.001 4.7e-09
psoriasis -2.500 8.0e-06

AA Sequence

MWLQDRIATFFFPKGMMLTTAALMLFFLHLGIFIRDVHNFCITYHYDHMSFHYTVVLMFSQVISICWAAM      1 - 70
GSLYAEMTENKYVCFSALTILMLNGAMFFNRLSLEFLAIEYREEHH                             71 - 116
//

Text Mined References (2)

PMID Year Title