Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.31
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession E9PQR5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINSLAVYRHRETDFGVGVRDHPGQHGKTP      1 - 70
SPQKLDNLIIIIIGFLRCYTFNILFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSIC     71 - 140
MHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELR    141 - 210
RRAEDYHKCKIPPSARKPLCNWVRMAAAEHRHSSGLPYWLYLTAETLKNRMGRQPPPPTQQHSITDNSLS    211 - 280
LKTPPECLLTPLPPSVDDNIKECPLAPLPPSPLPPSVDDNLKECLFVPLPPSPLPPSVDDNLKECLFVPL    281 - 350
PPSPLPPSVDDNLKTPPLATQEAEVEKPPKPKRWRVDEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTR    351 - 420
HCTQAWAIRINP                                                              421 - 432
//

Text Mined References (1)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.