Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession E9PQ53
Symbols

PANTHER Protein Class (1)

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFA      1 - 70
GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG                               71 - 114
//

Text Mined References (4)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.