Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession E9PQ53
Symbols

PANTHER Protein Class (1)

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFA      1 - 70
GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG                               71 - 114
//

Text Mined References (4)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.