Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.9e-23

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.800 2.9e-23

Synonym

Accession E9PJ23
Symbols NPIPB

Gene

AA Sequence

MVKLSIVLTPQFLSHDQSQLTKELQQHVKSVTCPCEYLRKVINSLAVYRHRETDFGVGVRDHPGQHGKTP      1 - 70
SPQKLDNLIIIIIGFLRRYTFNILFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSIC     71 - 140
MHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELR    141 - 210
RRAEDYHKCKIPPSARKPLCNWVRMVAAEHRHSSGLPYWPYLTAETLKNRMGRQPPPPTQQHSITDNSLS    211 - 280
LKTPTECLLTPLPPSVDDNIKECPLAPLPPSPLPPSVDDNLKECLFVPLPPSPLPPSVDDNLKTPPLATQ    281 - 350
EAEVEKPPKPKRWRVDEVEQSPKPKRRRVDEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCTQAWA    351 - 420
IRINP                                                                     421 - 425
//

Text Mined References (2)

PMID Year Title