Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MVKLSIVLTPRFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHRHRGTDFGGSPWLLIITVFLRS      1 - 70
YKFAISLCTSYLCVSFLKTIFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVETKVRAKI     71 - 140
CKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQAL    141 - 210
RRRAEDYYRCKITPSARKPLCNRVRMAAAEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSL    211 - 280
SLKTPPECLLTPLPPSALPSADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPPSAPPSADDNLKTP    281 - 350
PKCVCSLPFHPQRMIISRN                                                       351 - 369
//

Text Mined References (2)

PMID Year Title
18055785 2007 Novel retinal and cone photoreceptor transcripts revealed by human macular expression profiling.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.