Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession E9PI22
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQN      1 - 70
QQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIP     71 - 140
SVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAA    141 - 210
FPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK     211 - 279
//

Text Mined References (2)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.