Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MQSFLTLLKEHEDTCAPPAELVTLAGRLCRDFQDDLAQLQPLVTAILDSQLRLHLLDNADVALACARVLD      1 - 70
QQEQQQAACRLLEGCQVPGGSQELVQLWNDIHYRLVMRRLGVAALTPVQKFRCRKRNPPPPSLCPEGLKS     71 - 140
RNFPREVREKLHNFAVGVNTNPSKAERENLALETSLTPEQVYNWFANYRRRQRALPQHMKPAQQATAEDP    141 - 210
GARERGPDLLQPSGNPRVDSGFVDRPQWSEEREEKGPPQSPQTTQGPWEPLALAPDFPADETVSKPLDVS    211 - 280
GHPQSVQLEEGLGTSSGRTELRVGSFLVTQPPLQAPEFILTQSPPELAPAPSAFPGPVSAMELSQALPSS    281 - 350
QVQCSDSQASGDAFWGARMLLEFSGSSLG                                             351 - 379
//

Text Mined References (4)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.