Property Summary

NCBI Gene PubMed Count 38
Grant Count 4
R01 Count 4
Funding $215,380.58
PubMed Score 22.56
PubTator Score 136.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.110 0.005
Multiple myeloma 1.236 0.001
malignant mesothelioma 1.200 0.000
osteosarcoma -1.489 0.002
acute quadriplegic myopathy 1.097 0.000
adrenocortical carcinoma 1.082 0.001
intraductal papillary-mucinous neoplasm ... 1.300 0.007
lung cancer 2.500 0.002
colon cancer 1.300 0.006
invasive ductal carcinoma 1.200 0.011
ovarian cancer -1.700 0.000

Synonym

Accession E9PAV3
Symbols HSD48
NACA1
skNAC
NAC-alpha

Gene

Gene RIF (12)

PMID Text
25209525 Low NACA expression is associated with rhabdomyosarcoma.
24901053 depletion of alphaNAC in multiple types of cancer cells induce typical apoptotic cell death. This anti-apoptotic function is mediated by the FADD/c-Jun N-terminal kinase pathway.
22082360 [review] First evidence of a functional interaction between ATF4, FIAT (factor-inhibiting ATF4-mediated transcription) and alphaNAC (nascent polypeptide-associated complex and coactivator alpha).
21509594 NACA gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
20214399 identified a region in the NAC domain of the human NAC alpha-subunit as a new nucleic acid-binding region, which is blocked from binding nucleic acids in the heterodimeric complex by a helix region in the beta-subunit
19609276 Alpha NAC downregulation in hypoxic cells or NAC ablation by NAC short-interfering RNA (siRNA) leads to the initiation of ER stress responses, which results in caspase-dependent apoptosis.
17676665 HIV-1 gp120 downregulates the expression of nascent polypeptide-associated complex alpha subunit in T-cell lines
15784678 Altogether, these results characterize NACA as a new factor involved in the positive regulation of human erythroid-cell differentiation.
12699894 virtual Northern blots to analyze expression of NACA and ANX2 in progenitor cultures of nine children with Juvenile myelomonocytic leukemia and five healthy individuals
12406326 a novel isoform of alpha-nascent polypeptide-associated complex as IgE-defined autoantigen
More...

AA Sequence

MPGEATETVPATEQELPQPQAETAVLPMSSALSVTAALGQPGPTLPPPCSPAPQQCPLSAANQASPFPSP      1 - 70
STIASTPLEVPFPQSSSGTALPLGTAPEAPTFLPNLIGPPISPAALALASPMIAPTLKGTPSSSAPLALV     71 - 140
ALAPHSVQKSSAFPPNLLTSPPSVAVAESGSVITLSAPIAPSEPKTNLNKVPSEVVPNPKGTPSPPCIVS    141 - 210
TVPYHCVTPMASIQSGVASLPQTTPTTTLAIASPQVKDTTISSVLISPQNPGSLSLKGPVSPPAALSLST    211 - 280
QSLPVVTSSQKTAGPNTPPDFPISLGSHLAPLHQSSFGSVQLLGQTGPSALSDPTVKTISVDHSSTGASY    281 - 350
PSQRSVIPPLPSRNEVVPATVAAFPVVAPSVDKGPSTISSITCSPSGSLNVATSFSLSPTTSLILKSSPN    351 - 420
ATYHYPLVAQMPVSSVGTTPLVVTNPCTIAAAPTTTFEVATCVSPPMSSGPISNIEPTSPAALVMAPVAP    421 - 490
KEPSTQVATTLRIPVSPPLPDPEDLKNLPSSVLVKFPTQKDLQTVPASLEGAPFSPAQAGLTTKKDPTVL    491 - 560
PLVQAAPKNSPSFQSTSSSPEIPLSPEATLAKKSLGEPLPIGKPASSMTSPLGVNSSASVIKTDSYAGPD    561 - 630
SAGPLLKSSLITPTVAAFPLESADPAGVAPTTAKGTSTYTTTASPFLEGTVSLAPKNHPVKEGTLTTLPL    631 - 700
VPTASENCPVAPSPQNTCAPLATLVLAPEIPKSVPSPSLPPAGTPPGTKKVDGISHTSALAPVASSPKEC    701 - 770
PTEDSGASATASSKGTLTYLADSPSPLGVSVSPQTKRPPTKKGSAGPDTPIGNLSSPVSPVEASFLPENS    771 - 840
LSFQGSKDSPATTHSPTPPSPKGAPTPSAVTPLSPKGVTLPPKETPTPSVVNLPFPKEGPATPAPKQAPA    841 - 910
LSMTSSSPKKARATPAPKGIPASPSPKGAPTPPAATPPSPKGGPATPSPKWAPTPPAATPPSPKGGPATP    911 - 980
SPKGAPTPPAATPPSPKGGPATPSPKGAPTPPAVTPPSPKGSPAATPFPKGASTPPAATPPSPKGSPAAT    981 - 1050
PLPKGAPTTPAATLPSPKGGPATPSLKGAPTPPAATPPSPKGGPATPSPKGAPMPPAATPPSPKGGLATP   1051 - 1120
PHKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPS   1121 - 1190
PKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPATPPP   1191 - 1260
KGAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKGAPTPPAATPPSPKGSPGTPPPK   1261 - 1330
GAPTPPAVTPPSPKGTPTLPATTPSSKGGPTTPSSKEGPTPPAATPSHKGGPAMTPPSPKRGPAIPSPKG   1331 - 1400
DPTSPAVIPLSPKKAPATPVTREGAATPSKGDLTPPAVTPVSLKKAPATSAPKGGPATPSSKGDPTLPAV   1401 - 1470
TPPSPKEPPAPKQVATSSSPKKAPATPAPMGAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTPA   1471 - 1540
TLAPKEALIPPAMTVPSPKKTPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPKELLIPPAVTSPSP   1541 - 1610
KEAPTPPAVTPPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTCKMGATVPQASKGLPAKKGPTA   1611 - 1680
LKEVLVAPAPESTPIITAPTRKGPQTKKSSATSPPICPDPSAKNGSKGPLSTVAPAPLLPVQKDSSKTAK   1681 - 1750
GKDASHSPKGPLAPPESKASTPLTAAAFEKVLPKPESASVSAAPSPPVSLPLAPSPVPTLPPKQQFLPSS   1751 - 1820
PGLVLESPSKPLAPADEDELLPLIPPEPISGGVPFQSVLVNMPTPKSAGIPVPTPSAKQPVTKNNKGSGT   1821 - 1890
ESDSDESVPELEEQDSTQATTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIR   1891 - 1960
KSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESE   1961 - 2030
EEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM                         2031 - 2078
//

Publication (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25209525 2014 Overexpression of the skNAC gene in human rhabdomyosarcoma cells enhances their differentiation potential and inhibits tumor cell growth and spreading.
24901053 2014 ?NAC inhibition of the FADD-JNK axis plays anti-apoptotic role in multiple cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22082360 2011 Combinatorial control of ATF4-dependent gene transcription in osteoblasts.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...