Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.30
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.500 2.6e-05
Astrocytoma, Pilocytic 1.200 2.2e-07
atypical teratoid / rhabdoid tumor 1.300 6.6e-07
ependymoma 1.200 9.8e-09
glioblastoma 1.500 4.9e-07
group 3 medulloblastoma 1.500 1.5e-03
medulloblastoma, large-cell 1.700 8.9e-06
osteosarcoma -1.085 4.1e-04
ovarian cancer -1.500 3.9e-06
primitive neuroectodermal tumor 1.400 2.2e-05

AA Sequence

MAVVATLRLSAQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQS      1 - 70
IYIQRETQVRTPVTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQN     71 - 140
EHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFLPRSGLLQQEASHTGEKSNSKTECVSPFQCG    141 - 210
GAHYSHGDSMKHFSTKHILSQHQRLLPREECYVCCECGKSFSKYVSFSNHQRVHSGKRPYECGECEKSFS    211 - 280
QKSSLIQHQQFHTGGKPYGCEECGKYFSLEGYLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTG    281 - 350
ERPYKCGECEKSFSRKPSLSYHQRFGRPRWVDHKDRKEFKTSLGNIVKSCLF                      351 - 402
//

Text Mined References (5)

PMID Year Title