Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.30
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.085 0.000
posterior fossa group B ependymoma 1.300 0.000
glioblastoma 1.500 0.000
medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.400 0.000
adult high grade glioma 1.500 0.000
pilocytic astrocytoma 1.200 0.000
ovarian cancer -1.500 0.000

AA Sequence

MAVVATLRLSAQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVEDEAAPSKQS      1 - 70
IYIQRETQVRTPVTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQN     71 - 140
EHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFLPRSGLLQQEASHTGEKSNSKTECVSPFQCG    141 - 210
GAHYSHGDSMKHFSTKHILSQHQRLLPREECYVCCECGKSFSKYVSFSNHQRVHSGKRPYECGECEKSFS    211 - 280
QKSSLIQHQQFHTGGKPYGCEECGKYFSLEGYLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTG    281 - 350
ERPYKCGECEKSFSRKPSLSYHQRFGRPRWVDHKDRKEFKTSLGNIVKSCLF                      351 - 402
//

Text Mined References (5)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10520746 1998 Computer sequence analysis of human highly conserved zinc finger modules.