Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.8e-29
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 9.8e-29

AA Sequence

MSSGQQVWHTAVPPPRRSSSIASMPRSPSSAGSPRSPGTPGSERVASPLECSICFSGYDNIFKTPKELSC      1 - 70
THVFCLECLARLAAAQPVGRPGGEAVPCPFCRQPTAVPPAGAPALCTSRQLQARMPAHLRREEPVWLEGT     71 - 140
KLCCQPLPTTPGREPGFVCVDVGLSKPAEPPAPARDPAPRRGRLARCWARCRDWRRMALVSALLLMLFCV    141 - 210
ALWPVQCALKTGNLRCLPLPPRPPATSTAASPLGPLTDN                                   211 - 249
//

Text Mined References (2)

PMID Year Title