Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.58
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Osteoporosis 363 3.44 1.7

Expression

Synonym

Accession E5RQL4
Symbols FONG

Gene

PANTHER Protein Class (2)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (3)

AA Sequence

MSSSRVGLRLAACLLNVSEAGRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYKRSVITIATSVDKL      1 - 70
GLAEDLVLHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTGSEHGFCF     71 - 140
ALFFFFF                                                                   141 - 147
//

Text Mined References (7)

PMID Year Title