Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Osteoporosis 257
Schizophrenia 501

Expression

Gene RIF (3)

PMID Text
26492493 rs10203122 in FTCDNL1 is associated with a susceptibility to osteoporosis.
23303384 results suggest that Japanese subjects homozygous for the risk alleles of rs7605378 in FONG and rs12673629 in THSD7A have a significantly higher risk of vertebral fracture
21573128 A single nucleotide polymorphism (SNP), rs7605378 associated with osteoporosis, was identified, in a previously unknown gene on chromosome 2q33.1, FONG.

AA Sequence

MSSSRVGLRLAACLLNVSEAGRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYKRSVITIATSVDKL      1 - 70
GLAEDLVLHVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTGSEHGFCF     71 - 140
ALFFFFF                                                                   141 - 147
//

Text Mined References (7)

PMID Year Title
26492493 2015 Association Study between the FTCDNL1 (FONG) and Susceptibility to Osteoporosis.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23303384 2013 Association of the formiminotransferase N-terminal sub-domain containing gene and thrombospondin, type 1, domain-containing 7A gene with the prevalence of vertebral fracture in 2427 consecutive autopsy cases.
21573128 2011 Common variants in a novel gene, FONG on chromosome 2q33.1 confer risk of osteoporosis in Japanese.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.