Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 1.3e-02
atypical teratoid / rhabdoid tumor -1.100 2.6e-07
group 4 medulloblastoma -1.100 1.8e-05
inflammatory breast cancer -1.400 4.1e-03
interstitial cystitis -1.200 4.1e-03
oligodendroglioma -1.100 2.3e-02
ovarian cancer 1.100 2.0e-05

AA Sequence

MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEER      1 - 70
DHAGRTPLHLAVLRGHAPLVRLLLQRGAPVGAVDRAGRTALHEAAWHGHSRVAELLLQRGASAAARSGTG     71 - 140
LTPLHWAAALGHTLLAARLLEAPGPGPAAAEAEDARGWTAAHWAAAGGRLAVLELLAAGGAGLDGALLVA    141 - 210
AAAGRGAALRFLLARGARVDARDGAGATALGLAAALGRSQDIEVLLGHGADPGIRDRHGRSALHRAAARG    211 - 280
HLLAVQLLVTQGAEVDARDTLGLTPLHHASREGHVEVAGCLLDRGAQVDATGWLRKTPLHLAAERGHGPT    281 - 350
VGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEKECEGIESTG                         351 - 399
//

Text Mined References (5)

PMID Year Title