Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.55097936039451E-7
non-inflammatory breast cancer 208 5.08977260681953E-7
group 4 medulloblastoma 1875 1.77753191859538E-5
ovarian cancer 8492 1.99357065477605E-5
interstitial cystitis 2299 0.00409049893075754
astrocytic glioma 2241 0.0133835702732031
oligodendroglioma 2849 0.0231714819869516

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 0.013
oligodendroglioma -1.100 0.023
atypical teratoid / rhabdoid tumor -1.100 0.000
interstitial cystitis -1.200 0.004
group 4 medulloblastoma -1.100 0.000
non-inflammatory breast cancer -2.000 0.000
ovarian cancer 1.100 0.000

Synonym

Accession E5RJM6 J3KR93
Symbols

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEER      1 - 70
DHAGRTPLHLAVLRGHAPLVRLLLQRGAPVGAVDRAGRTALHEAAWHGHSRVAELLLQRGASAAARSGTG     71 - 140
LTPLHWAAALGHTLLAARLLEAPGPGPAAAEAEDARGWTAAHWAAAGGRLAVLELLAAGGAGLDGALLVA    141 - 210
AAAGRGAALRFLLARGARVDARDGAGATALGLAAALGRSQDIEVLLGHGADPGIRDRHGRSALHRAAARG    211 - 280
HLLAVQLLVTQGAEVDARDTLGLTPLHHASREGHVEVAGCLLDRGAQVDATGWLRKTPLHLAAERGHGPT    281 - 350
VGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEKECEGIESTG                         351 - 399
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
2302192 1990 Transcription of human endogenous retroviral long terminal repeat (LTR) sequence in a lung cancer cell line.