Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 0.013
oligodendroglioma -1.100 0.023
atypical teratoid / rhabdoid tumor -1.100 0.000
interstitial cystitis -1.200 0.004
group 4 medulloblastoma -1.100 0.000
non-inflammatory breast cancer -2.000 0.000
ovarian cancer 1.100 0.000

AA Sequence

MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGASVEER      1 - 70
DHAGRTPLHLAVLRGHAPLVRLLLQRGAPVGAVDRAGRTALHEAAWHGHSRVAELLLQRGASAAARSGTG     71 - 140
LTPLHWAAALGHTLLAARLLEAPGPGPAAAEAEDARGWTAAHWAAAGGRLAVLELLAAGGAGLDGALLVA    141 - 210
AAAGRGAALRFLLARGARVDARDGAGATALGLAAALGRSQDIEVLLGHGADPGIRDRHGRSALHRAAARG    211 - 280
HLLAVQLLVTQGAEVDARDTLGLTPLHHASREGHVEVAGCLLDRGAQVDATGWLRKTPLHLAAERGHGPT    281 - 350
VGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEKECEGIESTG                         351 - 399
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
2302192 1990 Transcription of human endogenous retroviral long terminal repeat (LTR) sequence in a lung cancer cell line.