Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession E5RJ46
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRTPKRTRSPKTKVSLRGETLTLQLTTVSLDTRHMVKRCDERHGRPLPHSQESQHGSATSKKAVRGTADT      1 - 70
APLERISAARGWALPMEATVSVFRAHQWQWN                                            71 - 101
//

Text Mined References (4)

PMID Year Title