Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSG      1 - 70
SLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISW     71 - 140
SPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG                                        141 - 174
//

Text Mined References (3)

PMID Year Title