Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSG      1 - 70
SLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISW     71 - 140
SPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG                                        141 - 174
//

Text Mined References (3)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.