Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
astrocytic glioma 2,241
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma 1.300 0.038
osteosarcoma 1.899 0.000

Synonym

Accession E2RYF7
Symbols PBMUCL2

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20981447 Study cloned 2 novel mucin-like genes designated panbronchiolitis related mucin-like 1 and 2 (PBMUCL1 and PBMUCL2) in the candidate region, which form a mucin-like gene cluster together with two adjacent genes.
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRYVPLLLLLLLLRCSERGGGVNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRYGIVGLSQSIS      1 - 70
TKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTK     71 - 140
DYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVDPGTTEDSVT    141 - 210
ADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGDTHLL                                 211 - 251
//

Text Mined References (10)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23001997 2012 Identification of a susceptibility locus in STAT4 for Behçet's disease in Han Chinese in a genome-wide association study.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21051598 2010 The major genetic determinants of HIV-1 control affect HLA class I peptide presentation.
20981447 2011 Molecular cloning of two novel mucin-like genes in the disease-susceptibility locus for diffuse panbronchiolitis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.