Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.6e-07
astrocytic glioma 2597 3.8e-02

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma 1.300 3.8e-02
osteosarcoma 1.899 1.6e-07

Gene RIF (3)

AA Sequence

MPRYVPLLLLLLLLRCSERGGGVNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRYGIVGLSQSIS      1 - 70
TKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTK     71 - 140
DYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVDPGTTEDSVT    141 - 210
ADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGDTHLL                                 211 - 251
//

Text Mined References (12)

PMID Year Title