Property Summary

NCBI Gene PubMed Count 34
PubMed Score 39.52
PubTator Score 36.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.400 8.3e-08
ependymoma 2.700 4.7e-18
glioblastoma 2.000 1.5e-08
group 3 medulloblastoma 2.300 2.5e-05
atypical teratoid/rhabdoid tumor 2.700 2.7e-11
medulloblastoma, large-cell 1.100 1.0e-03
primitive neuroectodermal tumor 2.200 9.0e-05
lung cancer 1.300 3.3e-04
active Crohn's disease 1.101 2.0e-02
pediatric high grade glioma 2.100 1.7e-07
pilocytic astrocytoma 1.600 7.6e-07
primary Sjogren syndrome 1.200 1.3e-03
lung carcinoma 1.500 1.1e-17
ductal carcinoma in situ 1.100 4.2e-03
invasive ductal carcinoma 2.100 3.4e-03
ulcerative colitis 1.200 3.2e-06

Gene RIF (17)

PMID Text
26103003 MiR-34a was down-regulated in colorectal cancer cells and inversely correlated with FMNL2 and E2F5 expressions. Our study suggests that miR-34a is an important tumor suppressor of CRC progression by targeting FMNL2 and E2F5.
25422988 miR-98 regulates muscle differentiation by altering the expression of the transcription factor E2F5 and, in turn, of multiple E2F5 targets.
24529171 In hepatocellular carcinoma cells hepatitis B virus down-regulates E2F5 expression by up-regulating expression of miR-181a.
24324077 expression of E2F5 in esphageal squamous cell cancer (ESCC) may be correlated with a worse prognosis of patients with ESCC
23377984 E2F5 may be a novel potential candidate marker for malignant prostate cancer
21274376 Data indicate that E2F5 is commonly overexpressed in primary hepatocellular carcinomas and show that E2F5 knockdown significantly repressed the growth of HCC cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20639900 Diverting the function of E2F5 from a cell-cycle repressor into an activator might contribute to the higher oncogenic potential of HPV18 when compared with other high-risk HPV types.
20181230 cell-cycle regulatory protein E2F5 might play a significant role in epithelial ovarian cancer pathogenesis
19738611 Observational study of gene-disease association. (HuGE Navigator)
19259095 Overexpression of E2F-5 correlates with a pathological basal phenotype and a worse clinical outcome.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18385796 Overexpression of E2F5/p130 in post-mitotic lens fiber cells does not affect normal differentiation, but can inhibit inappropriate cell cycle reentry induced by activator E2Fs. P130 is key player in inhibitory process.
16172982 E2F5 protein is down-regulated late in embryogenesis
12860972 EBV LPM1 blocks p16INK4 pathway by promoting nuclear export of E2F-5.
12789259 We investigated occupancy of ER-alpha promoter by pRb2/p130-E2F4/5-HDAC1-SUV39 H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 complexes, and provided a link between pRb2/p130 and chromatin-modifying enzymes in the regulation of ER-alpha transcription
12089160 the subcellular distribution of E2F-5 is tightly regulated in intact cells, through multiple functional domains that direct nucleocytoplasmic shuttling of this protein.

AA Sequence

MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTTKFVSLLQEAK      1 - 70
DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLKAEIEDL     71 - 140
ELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQ    141 - 210
KKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSER    211 - 280
SQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY        281 - 346
//

Text Mined References (36)

PMID Year Title
26103003 2015 MicroRNA-34a targets FMNL2 and E2F5 and suppresses the progression of colorectal cancer.
25422988 2015 miR-98 delays skeletal muscle differentiation by down-regulating E2F5.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24529171 2014 Up-regulated MicroRNA-181a induces carcinogenesis in hepatitis B virus-related hepatocellular carcinoma by targeting E2F5.
24324077 2013 E2F5 as an independent prognostic factor in esophageal squamous cell carcinoma.
23377984 2013 Analysis of genetic aberrations on chromosomal region 8q21-24 identifies E2F5 as an oncogene with copy number gain in prostate cancer.
21274376 2011 A potential oncogenic role of the commonly observed E2F5 overexpression in hepatocellular carcinoma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20639900 2010 The E2F5 repressor is an activator of E6/E7 transcription and of the S-phase entry in HPV18-associated cells.
20181230 2010 E2F5 status significantly improves malignancy diagnosis of epithelial ovarian cancer.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19259095 2009 Overexpression of E2F-5 correlates with a pathological basal phenotype and a worse clinical outcome.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18385796 2008 Overexpression of E2F5/p130, but not E2F5 alone, can inhibit E2F-induced cell cycle entry in transgenic mice.
17531812 2007 Evolutionarily conserved multisubunit RBL2/p130 and E2F4 protein complex represses human cell cycle-dependent genes in quiescence.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16360038 2005 Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.
16172982 2005 Changes in E2F5 intracellular localization in mouse and human choroid plexus epithelium with development.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12860972 2003 Epstein-Barr virus LMP1 blocks p16INK4a-RB pathway by promoting nuclear export of E2F4/5.
12789259 2003 pRb2/p130-E2F4/5-HDAC1-SUV39H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 multimolecular complexes mediate the transcription of estrogen receptor-alpha in breast cancer.
12150994 2002 E2F4/5 and p107 as Smad cofactors linking the TGFbeta receptor to c-myc repression.
12089160 2002 Active nuclear import and export pathways regulate E2F-5 subcellular localization.
11756542 2002 Nucleocytoplasmic shuttling of p130/RBL2: novel regulatory mechanism.
11319226 2001 Ca2+ and BMP-6 signaling regulate E2F during epidermal keratinocyte differentiation.
11030352 2000 E2F4 and E2F5 play an essential role in pocket protein-mediated G1 control.
10783242 2000 Regulation of E2F transcription by cyclin E-Cdk2 kinase mediated through p300/CBP co-activators.
9464260 1998 The molecular and functional characterization of E2F-5 transcription factor.
9190208 1997 Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.
9144196 1997 The subcellular localization of E2F-4 is cell-cycle dependent.
8589754 1995 Structural characterization and specificity of expression of E2F-5: a new member of the E2F family of transcription factors.
7958925 1994 E2F-4, a new member of the E2F gene family, has oncogenic activity and associates with p107 in vivo.
7958924 1994 E2F-4, a new member of the E2F transcription factor family, interacts with p107.
7892279 1995 E2F-4 and E2F-5, two members of the E2F family, are expressed in the early phases of the cell cycle.
7760804 1995 E2F-5, a new E2F family member that interacts with p130 in vivo.