Property Summary

NCBI Gene PubMed Count 61
PubMed Score 103.48
PubTator Score 67.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -4.295 2.2e-08
glioblastoma 1.300 4.2e-04
group 3 medulloblastoma 1.900 2.4e-05
atypical teratoid / rhabdoid tumor 1.200 4.9e-07
medulloblastoma, large-cell 1.800 4.0e-06
primitive neuroectodermal tumor 1.300 6.7e-03
Atopic dermatitis 1.100 5.5e-05
breast carcinoma 1.100 8.2e-03
adult high grade glioma 1.300 4.0e-04
lung adenocarcinoma 1.700 7.0e-09
inflammatory breast cancer 2.600 3.6e-03
ovarian cancer 1.100 3.4e-08

Protein-protein Interaction (4)

Gene RIF (36)

PMID Text
26617764 we validated for the first time that E2F2 acts as a tumor activator in non-small cell lung carcinoma.
26498144 Data indicate that microRNA miR-214 has tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3 and CDK6.
26474282 E2F2 loss results in increased lung metastasis in breast cancer, potentially functioning through a PTPRD dependent mechanism.
26369285 cell cycle-dependent transcription of the TRAIP gene by E2F1, E2F2, and E2F4 and rapid protein degradation leads to cell cycle-dependent expression with a maximum in G2/M
26012781 Elevated E2F2 expression in glioblastoma cells weakens the effect of elevated levels of miR-218.
25816091 miR218 and miR520a are crucial in the development of hepatocellular carcinoma via the inhibition of cell proliferation and cycle progression by downregulating E2F2.
25647078 Results show evidence that let-7a expression in osteosarcoma (OS) cells is significantly reduced and inversely correlated with E2F2 expression levels and that let-7a plays an important role in OS cell proliferation and tumorigenesis by targeting E2F2.
25362258 miR-31 regulated the proliferation of colon cancer cells by targeting E2F2.
24793496 Overall, miR-155 plays an important role in colorectal carcinoma tumorigenesis by negative regulation of its targets including E2F2.
24446828 E2F2 knockdown can inhibit hESC proliferation and tumorigenicity without significantly harming stemness.
24397353 Data suggest that the uniquely increased expression of CD38 and E2F2 in rheumatoid arthritis (RA) synovial tissues contribute to the immunoactivation of the disease.
23809258 these results indicate that LXR ligands target gene networks, including those regulated by E2F family members, are critical for tumor biology and disease progression and merit further consideration as potential agents
23297349 ALY is a novel E2F2-interacting protein and a relevant modulator of E2F-responsive gene expression.
22999819 miR-125b plays important roles in regulating the proliferation of cancer stem cells by directly targeting E2F2.
22688350 Low expression of E2F2 may reflect functional redundancy between members of the E2F family, in this case between E2F1 and E2F2.
22531302 Overexpression of E2F transcription factor 2 is associated with nonepithelial ovarian cancer.
22344756 E2F1 and E2F2 genetic variants may jointly play important roles in head and neck squamous cell carcinoma
22125623 Findings suggest that the deregulated activity of E2F in cancer cells causes increased activation of the Kpnbeta1 and Kpnalpha2 promoters, leading to elevated levels of these proteins, and ultimately impacting the cancer phenotype.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20855524 Data report that ANCCA directly interacts with E2F1 to E2F3 in its complex with MLL and that its N terminus interacts with both the N and C termini of E2F1.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20418948 the 3'UTR of E2F2 and CCND2 were directly bound to let-7a and let-7a down-regulated the expression of E2F2 and CCND2, suppressing prostate cancer cell proliferation in culture
20226085 Microarray expression analysis indicated that E2F1 and E2F2 are downstream genes in the KDM5B pathway.
19748357 miR-24 Inhibits cell proliferation by targeting E2F2, MYC, and other cell-cycle genes via binding to "seedless" 3'UTR microRNA recognition elements.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19690970 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19142864 Decreased expression of E2F2 is associated with Increased expression of HER2 in breast tumors.
19142864 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18345030 Myc is required to allow the interaction of the E2F1 protein with the E2F gene promoters.
17916908 identify a novel E2F-binding site in the survivin promoter and show that mutation of either the p53- or E2F-binding sites is sufficient to increase promoter activity
17588684 Up-regulation of E2F2 was detected in a set of 54 astrocytomas of different grades and significantly associated with malignancy.
17341621 Proliferation-promoting E2F transcription factor E2F-2 plays a pivotal role in the tumor biology of ovarian cancer.
17135249 E2F1, E2F2, and E2F3 directly bind the promoter of the mir-17-92 cluster, activating its transcription. miR-20a from the mir-17-92 cluster in turn modulates the translation of E2F2 and E2F3, suggesting an autoregulatory feedback loop.
12566389 E2F2 has a role in blood pressure regulation via a component of the endothelin system
12411495 determination of interaction with RYBP and YY1

AA Sequence

MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPGTCLDATPHGP      1 - 70
EGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKK     71 - 140
FIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFEDPTRPGKQQQL    141 - 210
GQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVP    211 - 280
DRTEDNLQIYLKSTQGPIEVYLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVP    281 - 350
APAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE    351 - 420
GISDLFDSYDLGDLLIN                                                         421 - 437
//

Text Mined References (61)

PMID Year Title
26617764 2015 E2F2 induction in related to cell proliferation and poor prognosis in non-small cell lung carcinoma.
26498144 2016 miR-214/199a/199a* cluster levels predict poor survival in hepatocellular carcinoma through interference with cell-cycle regulators.
26474282 2015 Increased metastasis with loss of E2F2 in Myc-driven tumors.
26369285 2015 The TRAF-interacting protein (TRAIP) is a novel E2F target with peak expression in mitosis.
26012781 2015 MiR-218 Inhibited Growth and Metabolism of Human Glioblastoma Cells by Directly Targeting E2F2.
25816091 2015 MicroRNA-218 and microRNA-520a inhibit cell proliferation by downregulating E2F2 in hepatocellular carcinoma.
25647078 2015 Tumor-suppressive microRNA-let-7a inhibits cell proliferation via targeting of E2F2 in osteosarcoma cells.
25362258 2015 miR-31 promotes proliferation of colon cancer cells by targeting E2F2.
24793496 2014 miR-155 regulates the proliferation and cell cycle of colorectal carcinoma cells by targeting E2F2.
24446828 2014 Knockdown of E2F2 inhibits tumorigenicity, but preserves stemness of human embryonic stem cells.
24397353 2014 CD38 and E2F transcription factor 2 have uniquely increased expression in rheumatoid arthritis synovial tissues.
23809258 2013 Liver × receptor ligands disrupt breast cancer cell proliferation through an E2F-mediated mechanism.
23297349 2013 The nuclear protein ALY binds to and modulates the activity of transcription factor E2F2.
22999819 2012 miR-125b regulates the proliferation of glioblastoma stem cells by targeting E2F2.
22688350 2014 The relationship between E2F family members and tumor growth in colorectal adenocarcinomas: A comparative immunohistochemical study of 100 cases.
22531302 2012 Molecular markers associated with nonepithelial ovarian cancer in formalin-fixed, paraffin-embedded specimens by genome wide expression profiling.
22344756 2012 Combined effects of E2F1 and E2F2 polymorphisms on risk and early onset of squamous cell carcinoma of the head and neck.
22125623 2011 Overexpression of Kpn?1 and Kpn?2 importin proteins in cancer derives from deregulated E2F activity.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20855524 2010 Chromatin loading of E2F-MLL complex by cancer-associated coregulator ANCCA via reading a specific histone mark.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20418948 2010 MicroRNA let-7a inhibits proliferation of human prostate cancer cells in vitro and in vivo by targeting E2F2 and CCND2.
20226085 2010 Overexpression of the JmjC histone demethylase KDM5B in human carcinogenesis: involvement in the proliferation of cancer cells through the E2F/RB pathway.
19748357 2009 miR-24 Inhibits cell proliferation by targeting E2F2, MYC, and other cell-cycle genes via binding to "seedless" 3'UTR microRNA recognition elements.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19690970 2009 Genetic variants in the cell cycle control pathways contribute to early onset colorectal cancer in Lynch syndrome.
19142864 2009 Polymorphic loci of E2F2, CCND1 and CCND3 are associated with HER2 status of breast tumors.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18345030 2008 A role for Myc in facilitating transcription activation by E2F1.
17916908 2008 Survivin repression by p53, Rb and E2F2 in normal human melanocytes.
17588684 Expression of HOXC9 and E2F2 are up-regulated in CD133(+) cells isolated from human astrocytomas and associate with transformation of human astrocytes.
17380128 2007 Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.
17341621 2006 Expression of the E2F family of transcription factors and its clinical relevance in ovarian cancer.
17135249 2007 An E2F/miR-20a autoregulatory feedback loop.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16360038 2005 Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.
15735762 2005 Induction of human metallothionein 1G promoter by VEGF and heavy metals: differential involvement of E2F and metal transcription factors.
15716352 2005 EAPP, a novel E2F binding protein that modulates E2F-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12566389 2003 Differential binding of transcription factor E2F-2 to the endothelin-converting enzyme-1b promoter affects blood pressure regulation.
12502741 2002 Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411495 2002 Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function.
12145330 2002 Reproductive cycle regulation of nuclear import, euchromatic localization, and association with components of Pol II mediator of a mammalian double-bromodomain protein.
11733001 2001 ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3).
11719808 2001 The E2F1-3 transcription factors are essential for cellular proliferation.
10965846 2000 RING3 kinase transactivates promoters of cell cycle regulatory genes through E2F.
10727462 2000 Deregulated E2F transcriptional activity in autonomously growing melanoma cells.
9694791 1998 The regulation of E2F by pRB-family proteins.
9688145 1998 Differential activities of E2F family members: unique functions in regulating transcription.
9190208 1997 Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.
9144196 1997 The subcellular localization of E2F-4 is cell-cycle dependent.
8846921 1996 Differential effects of cdk2 and cdk3 on the control of pRb and E2F function during G1 exit.
8832394 1996 Nuclear localization of DP and E2F transcription factors by heterodimeric partners and retinoblastoma protein family members.
8755520 1996 DP-2, a heterodimeric partner of E2F: identification and characterization of DP-2 proteins expressed in vivo.
8657142 1996 Cell cycle-regulated association of E2F1 and Sp1 is related to their functional interaction.
8657141 1996 Interaction of Sp1 with the growth- and cell cycle-regulated transcription factor E2F.
8246996 1993 The retinoblastoma protein binds to a family of E2F transcription factors.
8246995 1993 Cloning and characterization of E2F-2, a novel protein with the biochemical properties of transcription factor E2F.
7739537 1995 In vivo association of E2F and DP family proteins.