Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 4.6e-03
astrocytoma 1.300 2.4e-21
atypical teratoid / rhabdoid tumor 1.300 1.1e-08
ependymoma 1.300 4.8e-09
glioblastoma 1.300 1.4e-06
group 3 medulloblastoma 2.000 1.9e-04
invasive ductal carcinoma 1.100 2.2e-03
medulloblastoma, large-cell 1.200 6.6e-05
oligodendroglioma 1.100 1.9e-10
ovarian cancer 2.400 4.5e-04
primary pancreatic ductal adenocarcinoma 1.093 4.6e-03
primitive neuroectodermal tumor 1.100 1.1e-03
subependymal giant cell astrocytoma 1.026 4.7e-02

Gene RIF (1)

AA Sequence

MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA                             1 - 47
//

Text Mined References (7)

PMID Year Title