Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.99649155501666E-21
astrocytoma 1493 2.43576119393418E-21
oligodendroglioma 2849 1.89440189132477E-10
atypical teratoid / rhabdoid tumor 4369 1.10254115183393E-8
posterior fossa group B ependymoma 1530 1.90591063149194E-8
pediatric high grade glioma 2712 4.04361801896845E-6
medulloblastoma, large-cell 6234 6.61609839445794E-5
group 3 medulloblastoma 2254 1.86637287584744E-4
ovarian cancer 8492 4.47838877092488E-4
primitive neuroectodermal tumor 3031 0.00108954884177674
invasive ductal carcinoma 2950 0.00215559501300679
primary pancreatic ductal adenocarcinoma 1271 0.00464953680326652
subependymal giant cell astrocytoma 2287 0.0470241640804223

Expression

Synonym

Accession E0CX11
Symbols PL-5283

Gene

Gene RIF (1)

PMID Text
17720804 reports the identification by tandem mass spec of a novel protein, proteolipid with a mass of 5,283 Da, (PL-5283).

AA Sequence

MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA                             1 - 47
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
17720804 2007 Identification of membrane proteins by tandem mass spectrometry of protein ions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.