Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.48
PubTator Score 6.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 4.9e-03
chronic rhinosinusitis -1.621 7.6e-03
colon cancer -1.200 2.9e-02
cystic fibrosis 1.100 1.2e-03
glioblastoma -1.700 2.0e-02
group 3 medulloblastoma -1.700 2.6e-02
interstitial cystitis -1.200 9.2e-03
intraductal papillary-mucinous adenoma (... -2.000 1.6e-06
intraductal papillary-mucinous carcinoma... -2.000 7.6e-07
intraductal papillary-mucinous neoplasm ... -2.000 4.3e-04
lung cancer 1.100 9.2e-04
malignant mesothelioma -1.500 6.8e-07
medulloblastoma, large-cell -1.300 4.3e-04
osteosarcoma 1.423 1.3e-03
ovarian cancer -1.400 3.6e-06
Pick disease -1.100 1.5e-03
psoriasis -1.700 2.4e-03
severe Alzheimer's disease -1.047 4.2e-02

Gene RIF (6)

AA Sequence

MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWR      1 - 70
RLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTS     71 - 140
QLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQ    141 - 210
AFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEE    211 - 280
DFLKLFDRWKEEEKEKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFK    281 - 350
EDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEE    351 - 420
LGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPM    421 - 490
VHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINA    491 - 560
DIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDQCSVSQMDTLSTGEV    561 - 630
PKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGP    631 - 700
LPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVP    701 - 770
EMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKG    771 - 840
EGLQENESSTLKSSLVTVTDWSDTSDV                                               841 - 867
//

Text Mined References (17)

PMID Year Title