Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.547 1.6e-02
Breast cancer 2.600 2.5e-02
chronic rhinosinusitis -1.486 1.2e-02
lung cancer 1.100 1.4e-03
osteosarcoma -2.052 1.3e-07
posterior fossa group B ependymoma 1.200 1.7e-04
psoriasis -2.200 1.3e-04
tuberculosis -1.400 4.4e-05

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGYGENNTFKYIK      1 - 70
PITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVLKDSSRQEFKNGFVGSKLKKK     71 - 140
YKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQSQSPGFAHVSGQKCLTSTEIMRIQRETDFLK    141 - 210
CAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQP    211 - 280
QASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEA    281 - 350
SFCGWCGAMLGIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL    351 - 420
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYWRRQLDHISAH    421 - 490
LRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAAEGDG    491 - 560
GLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKEQLIPENRLLLKEVGPTGEGRVSVIEQLLDE    561 - 630
GADPNCCDEDNRPVITVAVMNKHHEAIPVLVQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCN    631 - 700
ASIQKKNAGGQTAYDLALNTGDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC                      701 - 752
//

Text Mined References (11)

PMID Year Title