Property Summary

NCBI Gene PubMed Count 13
PubMed Score 29.13
PubTator Score 13.10

Knowledge Summary

Patent (1,347)

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 6.4e-08
malignant mesothelioma 3163 9.3e-07
lung adenocarcinoma 2714 4.2e-06
lung cancer 4473 6.8e-04
Disease Target Count Z-score Confidence
Down syndrome 548 3.371 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -2.200 9.3e-07
lung cancer -1.200 6.8e-04
posterior fossa group B ependymoma 1.200 6.4e-08
lung adenocarcinoma 1.100 4.2e-06

Gene RIF (6)

PMID Text
23415227 Study identified the dual specificity tyrosine-phosphorylation-regulated kinase 3 (DYRK3) as a protein with the ability to condense P-granule-like speckles in the cytosol and to prevent stress granule dissolution via its N-terminal domain when it is in a kinase-inactive form.
21693704 the lipid raft-dependent endocytosis process mediates C. neoformans internalization into HBMEC and the CD44 protein of the hosts, cytoskeleton, and intracellular kinase-DYRK3 are involved in this process
20167603 DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
18854306 DYRK3 dual-specificity kinase attenuates erythropoiesis during anemia
15607427 DYRK3, expression is strong in erythroid cells and testis, but is also detected in adult kidney and liver
12356771 DYRK3 has roles in kinase activation, binding to CREB, and hematopoietic progenitor cell survival

AA Sequence

MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFT      1 - 70
GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVP     71 - 140
LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYE    141 - 210
VLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTF    211 - 280
RNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSS    281 - 350
TKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC    351 - 420
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGC    421 - 490
DDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVG    491 - 560
IANKLKANLMSETNGSIPLCSVLPKLIS                                              561 - 588
//

Text Mined References (16)

PMID Year Title
23415227 2013 Dual specificity kinase DYRK3 couples stress granule condensation/dissolution to mTORC1 signaling.
21693704 2011 Invasion of Cryptococcus neoformans into human brain microvascular endothelial cells is mediated through the lipid rafts-endocytic pathway via the dual specificity tyrosine phosphorylation-regulated kinase 3 (DYRK3).
20167603 2010 DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1.
18854306 2008 DYRK3 dual-specificity kinase attenuates erythropoiesis during anemia.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15607427 2005 DYRK gene structure and erythroid-restricted features of DYRK3 gene expression.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356771 2002 DYRK3 activation, engagement of protein kinase A/cAMP response element-binding protein, and modulation of progenitor cell survival.
10779429 2000 REDK, a novel human regulatory erythroid kinase.
9845759 1998 [Molecular cloning and characterization of novel protein kinase gene DYRK3].
9748265 1998 Sequence characteristics, subcellular localization, and substrate specificity of DYRK-related kinases, a novel family of dual specificity protein kinases.