Property Summary

Ligand Count 6
NCBI Gene PubMed Count 13
PubMed Score 29.13
PubTator Score 13.10

Knowledge Summary

Patent (1,347)

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 6.4e-08
malignant mesothelioma 3232 9.3e-07
lung adenocarcinoma 2716 4.2e-06
lung cancer 4740 6.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Down syndrome 499 3.373 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.100 4.2e-06
lung cancer -1.200 6.8e-04
malignant mesothelioma -2.200 9.3e-07
posterior fossa group B ependymoma 1.200 6.4e-08

Gene RIF (6)

AA Sequence

MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFT      1 - 70
GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVP     71 - 140
LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYE    141 - 210
VLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTF    211 - 280
RNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSS    281 - 350
TKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC    351 - 420
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGC    421 - 490
DDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVG    491 - 560
IANKLKANLMSETNGSIPLCSVLPKLIS                                              561 - 588
//

Text Mined References (16)

PMID Year Title