Property Summary

Ligand Count 6
NCBI Gene PubMed Count 32
PubMed Score 36.49
PubTator Score 27.91

Knowledge Summary

Patent (3,632)


  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.588 2.6e-04
chronic kidney disease 1.100 3.7e-02
Crohn's disease -1.589 1.6e-03
cystic fibrosis -1.107 5.2e-05
dermatomyositis 1.200 1.3e-02
ependymoma 1.800 1.7e-02
gastric carcinoma 1.200 1.7e-02
glioblastoma 1.100 1.0e-04
group 3 medulloblastoma 2.300 1.2e-06
intraductal papillary-mucinous adenoma (... 1.100 2.9e-03
intraductal papillary-mucinous carcinoma... 1.400 7.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.5e-03
juvenile dermatomyositis 1.007 8.0e-05
lung cancer 1.900 3.1e-03
medulloblastoma, large-cell 1.600 3.9e-04
non-small cell lung cancer 1.225 3.1e-21
oligodendroglioma 1.100 2.1e-02
osteosarcoma 1.309 1.1e-03
ovarian cancer 1.200 3.2e-05
Pick disease 1.100 1.6e-03
primitive neuroectodermal tumor 1.500 1.1e-04
psoriasis 1.200 4.4e-04
Rheumatoid arthritis 1.100 2.5e-03
sarcoidosis 1.300 1.5e-02
tuberculosis and treatment for 6 months 1.100 1.1e-03
ulcerative colitis -1.948 3.0e-04

Protein-protein Interaction (3)

Gene RIF (20)

AA Sequence

TSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS                                 561 - 601

Text Mined References (46)

PMID Year Title