Property Summary

NCBI Gene PubMed Count 40
PubMed Score 49.49
PubTator Score 50.49

Knowledge Summary

Patent (3,127)

TINX Plot

  Disease (4)

Disease Target Count
ovarian neoplasm 97
Disease Target Count Z-score Confidence
Obesity 616 0.0 4.0
diabetes mellitus 1663 0.0 4.0
Disease Target Count Z-score Confidence
Down syndrome 548 3.216 1.6
Cancer 2346 3.04 1.5

Expression

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
488883 summary 29 / 0 / 0 qHTS for Inhibitors of DYRK1B: Summary
504429 confirmatory 57 / 0 / 8 Kinase Inhibition Study on Inhibitors of Dyrk1b (Reaction Biology data)
624046 confirmatory 27 / 1 / 4 Reaction Biology data for inhibitors of DYRK1B: Probe SAR

Gene RIF (18)

PMID Text
26346493 The study shows that DYRK1B is a novel ERK2 substrate, uncovering new links between two kinases involved in cell fate decisions.
25777618 NKX3.1 and DYRK1B were shown to interact via the DYRK1B kinase domain. In vitro kinase assay showed that DYRK1B phosphorylated NKX3.1 at serine 185, a residue critical for NKX3.1 steady-state turnover.
25696812 Data reveal a novel role for miR-9 in regulation of the NFAT pathway by targeting KPNB1 and DYRK1B.
24827035 A founder mutation was identified in DYRK1B, substituting cysteine for arginine at position 102 in 3 families with metabolic syndrome.
24590896 Upregulation of Mirk mRNA expression is mediated by CREB binding to two sites in the Mirk promoter upstream of the transcription start site and one site within exon 4.
24134204 DYRK1B is a novel Thr(286)-CCND1 kinase that acts independently of GSK3beta to promote CCND1 degradation.
22159921 Mirk/Dyrk1B plays an important role in ovarian cancer cell survival through modulating FoxO translocation.
20512148 In line with a redirection of autocrine toward paracrine HH signaling by a KRAS-DYRK1B network, we find high levels of GLI1 expression restricted to the stromal compartment and not to SHH-expressing tumor cells in pancreatic adenocarcinoma.
20042639 the kinase Mirk is essential for the growth and survival of osteosarcoma cells.
19542220 Mirk, through regulating cyclin D turnover, and the CDK inhibitor p27, as shown by depletion studies, functioned independently and additively to regulate the exit of tumor cells from quiescence.
19351855 Quiescent pancreatic cancer cells depleted of Mirk became less viable because they were damaged by ROS, and had increased levels of G(1) cyclins to prime cells to escape quiescence.
18818203 BCL2 and BCL-xL facilitation of G0 quiescence requires BAX, BAK, and p27 phosphorylation by Mirk
17046823 GSK-3beta but also DYRK1B modulates cyclin D1 subcellular localization by the phosphorylation of Thr(288). These results suggest that DIF-3 induces degradation of cyclin D1 through the GSK-3beta- and DYRK1B-mediated threonine phosphorylation in HeLa cells
16845176 This review summarizes the known regulators and functions of Mirk kinase and outlines opportunities for future studies of Mirk in the fields of muscle and tumor biology.
16618736 Mirk is a survival factor for pancreatic ductal adenocarcinoma. Because knockout of Mirk does not cause embryonic lethality, Mirk is not essential for normal cell growth.
15851482 Mirk is anti-apoptotic in myoblasts
12384504 p38 MAP Kinase suppresses the function of Mirk as a transcriptional activator only when cells are proliferating
11980910 activation by MKK2 and role as transcriptional activator of HNF1alpha

AA Sequence

MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRR      1 - 70
AQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIK     71 - 140
IIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVS    141 - 210
LNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYR    211 - 280
SPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERL    281 - 350
PGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI    351 - 420
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYC    421 - 490
GGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPP    491 - 560
PELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAASS     561 - 629
//

Text Mined References (42)

PMID Year Title
26346493 2016 Identification of DYRK1B as a substrate of ERK1/2 and characterisation of the kinase activity of DYRK1B mutants from cancer and metabolic syndrome.
25777618 2015 The Tumor Suppressor NKX3.1 Is Targeted for Degradation by DYRK1B Kinase.
25696812 2015 miR-9 enhances the transactivation of nuclear factor of activated T cells by targeting KPNB1 and DYRK1B.
24827035 2014 A form of the metabolic syndrome associated with mutations in DYRK1B.
24590896 2014 Mirk/dyrk1B kinase is upregulated following inhibition of mTOR.
24134204 2014 A novel DYRK1B inhibitor AZ191 demonstrates that DYRK1B acts independently of GSK3? to phosphorylate cyclin D1 at Thr(286), not Thr(288).
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23114871 2013 Ovarian cancer cells, not normal cells, are damaged by Mirk/Dyrk1B kinase inhibition.
22998443 2012 Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B.
22918246 2012 Emerging role of DYRK family protein kinases as regulators of protein stability in cell cycle control.
22159921 2012 The involvement of FoxO in cell survival and chemosensitivity mediated by Mirk/Dyrk1B in ovarian cancer.
21878655 2011 Inactivation of mirk/dyrk1b kinase targets quiescent pancreatic cancer cells.
20940704 2010 The WD40-repeat protein Han11 functions as a scaffold protein to control HIPK2 and MEKK1 kinase functions.
20857490 2011 Transient arrest in a quiescent state allows ovarian cancer cells to survive suboptimal growth conditions and is mediated by both Mirk/dyrk1b and p130/RB2.
20512148 2010 DYRK1B-dependent autocrine-to-paracrine shift of Hedgehog signaling by mutant RAS.
20042639 2010 The kinase Mirk is a potential therapeutic target in osteosarcoma.
19633423 2009 Mirk/Dyrk1B, a novel therapeutic target, mediates cell survival in non-small cell lung cancer cells.
19542220 2009 Mirk regulates the exit of colon cancer cells from quiescence.
19351855 2009 Mirk/Dyrk1B maintains the viability of quiescent pancreatic cancer cells by reducing levels of reactive oxygen species.
18818203 2008 G0 function of BCL2 and BCL-xL requires BAX, BAK, and p27 phosphorylation by Mirk, revealing a novel role of BAX and BAK in quiescence regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17671193 2007 The survival kinase Mirk/Dyrk1B is a downstream effector of oncogenic K-ras in pancreatic cancer.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17046823 2006 Involvement of GSK-3beta and DYRK1B in differentiation-inducing factor-3-induced phosphorylation of cyclin D1 in HeLa cells.
16845176 2006 Mirk/Dyrk1B: a multifunctional dual-specificity kinase involved in growth arrest, differentiation, and cell survival.
16618736 2006 The kinase Mirk/Dyrk1B mediates cell survival in pancreatic ductal adenocarcinoma.
16257974 2005 The survival kinase Mirk/dyrk1B is activated through Rac1-MKK3 signaling.
15851482 2005 Mirk/Dyrk1B mediates survival during the differentiation of C2C12 myoblasts.
15546868 2005 Mirk/dyrk1B decreases the nuclear accumulation of class II histone deacetylases during skeletal muscle differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14593110 2004 Phosphorylation of Ser640 in muscle glycogen synthase by DYRK family protein kinases.
14500717 2003 Serine/threonine kinase Mirk/Dyrk1B is an inhibitor of epithelial cell migration and is negatively regulated by the Met adaptor Ran-binding protein M.
12633499 2003 Alternative splicing variants of dual specificity tyrosine phosphorylated and regulated kinase 1B exhibit distinct patterns of expression and functional properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12455049 2003 Rapid turnover of cell-cycle regulators found in Mirk/dyrk1B transfectants.
12384504 2002 The transcriptional activator Mirk/Dyrk1B is sequestered by p38alpha/beta MAP kinase.
11980910 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha.
10910078 2000 Mirk protein kinase is a mitogen-activated protein kinase substrate that mediates survival of colon cancer cells.
9918863 1999 Cloning and characterization of DYRK1B, a novel member of the DYRK family of protein kinases.
9748265 1998 Sequence characteristics, subcellular localization, and substrate specificity of DYRK-related kinases, a novel family of dual specificity protein kinases.