Property Summary

Ligand Count 64
NCBI Gene PubMed Count 131
PubMed Score 506.59
PubTator Score 204.94

Knowledge Summary

Patent (17,572)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.200 1.6e-02
dermatomyositis 1.300 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
juvenile dermatomyositis 1.075 3.7e-09
Multiple myeloma 2.066 8.8e-04
osteosarcoma -1.098 4.0e-05
ovarian cancer -1.600 6.5e-06
Waldenstrons macroglobulinemia 1.176 3.5e-02

PDB (19)

Gene RIF (97)

AA Sequence

MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQV      1 - 70
MPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGY     71 - 140
DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELM    141 - 210
NKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPE    211 - 280
LSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCI    281 - 350
LVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT    351 - 420
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTS    421 - 490
NSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQ    491 - 560
QFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRP    561 - 630
RVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDV    631 - 700
NLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS           701 - 763
//

Text Mined References (143)

PMID Year Title