Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.34
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.324 4.5e-02
malignant mesothelioma -3.500 2.8e-09
astrocytic glioma -2.800 2.1e-03
ependymoma -2.600 1.2e-02
oligodendroglioma -3.000 1.7e-02
group 4 medulloblastoma -1.600 6.2e-06
atypical teratoid / rhabdoid tumor -1.600 2.8e-06
medulloblastoma, large-cell -1.900 5.0e-05
primitive neuroectodermal tumor -1.700 5.6e-03
acute quadriplegic myopathy 1.146 6.5e-05
progressive supranuclear palsy -1.100 1.6e-02
ovarian cancer -1.900 2.9e-05
dermatomyositis 1.200 3.3e-03

 GO Function (1)

Gene RIF (2)

PMID Text
21166973 These data show that both DYNLT1 and DYNLT3 interact with L2 of human papillomavirus 16 during virus infection.
20668116 The N-terminal half of pUL35, in particular residues 30-43, was identified as a common region for the binding of DYNLT1 and DYNLT3.

AA Sequence

MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV      1 - 70
VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL                             71 - 116
//

Text Mined References (18)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
21166973 2011 Identification of the dynein light chains required for human papillomavirus infection.
20668116 2010 Identification of binding domains in the herpes simplex virus type 1 small capsid protein pUL35 (VP26).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17676955 2007 Dynein modifiers in C. elegans: light chains suppress conditional heavy chain mutants.
17289665 2007 The DYNLT3 light chain directly links cytoplasmic dynein to a spindle checkpoint protein, Bub3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16079286 2005 Dynein light chain rp3 acts as a nuclear matrix-associated transcriptional modulator in a dynein-independent pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15117959 2004 Herpes simplex virus type 1 capsid protein VP26 interacts with dynein light chains RP3 and Tctex1 and plays a role in retrograde cellular transport.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11746667 2001 Light chains of mammalian cytoplasmic dynein: identification and characterization of a family of LC8 light chains.
11425878 2001 Cytoplasmic dynein regulation by subunit heterogeneity and its role in apical transport.
9790665 1998 Cytoplasmic dynein contains a family of differentially expressed light chains.
8004092 1994 Identification of a gene from Xp21 with similarity to the tctex-1 gene of the murine t complex.