Property Summary

NCBI Gene PubMed Count 37
PubMed Score 210.32
PubTator Score 140.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.000 3.3e-02
ependymoma 2.000 3.9e-02
cutaneous lupus erythematosus 1.100 3.4e-03
psoriasis 1.300 1.6e-04
astrocytoma 1.800 1.4e-32
glioblastoma 2.000 1.4e-04
oligodendroglioma 1.700 9.6e-17
osteosarcoma 1.133 1.4e-05
group 3 medulloblastoma 2.200 2.3e-05
atypical teratoid/rhabdoid tumor 1.900 5.8e-10
primitive neuroectodermal tumor 1.700 3.2e-05
juvenile dermatomyositis 1.014 1.5e-10
primary pancreatic ductal adenocarcinoma 1.093 2.1e-03
diabetes mellitus -1.500 1.6e-03
pediatric high grade glioma 1.400 4.7e-06
pilocytic astrocytoma 1.200 3.1e-06
subependymal giant cell astrocytoma 1.784 2.7e-02
ductal carcinoma in situ 1.100 1.6e-03
ovarian cancer -1.700 3.5e-06
pancreatic cancer 1.100 3.0e-03
dermatomyositis 1.100 2.9e-03

Gene RIF (19)

PMID Text
26792716 The results implicate MTs/DYNLT1 as drivers of Vpr nuclear import and HIV infection, with important therapeutic implications.
26432663 Study reports a defect in the expression of DYNLT1 in the germ cells of infertile human males and implicates DYNLT1 in spermatogonial cell division and differentiation.
26227614 Data suggest that both microtubule-associated DYNLT (dynein light chain Tctex-type 1) and cytoplasmic DYNLT (dynein 1 intermediate chain 2 DYNC1LI2) are equally able to bind to small GTPases Rab3D (Rab3d GTPase) and RagA (Ras-related GTP binding A).
25944661 DYNLT1 is enriched at focal concentrations of CT850 on the chlamydial inclusion membrane that are known to interact with dynein and microtubules.
25928583 Reveal a dynein independent role of Tctex-1 at the kinetochore to enhance the stability of kinetochore-microtubule attachment.
24170091 Data suggest that DYNLT1 phosphorylation at serine S82 is involved in microtubule and mitochondria regulation, and their interaction and cooperation contribute to the cellular hypoxic tolerance.
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22028875 Dynlt1 modulates orexin signaling by regulating OX1R
21835165 A link between REIC/Dkk- 3 and Tctex-1 may therefore be of significance for understanding the molecular functions of the proteins in ER stress signaling and the intracellular dynein motor dynamics, respectively.
21767858 These data show that Tctex-1 may play a role in late stages of viral replication through its interaction with the flavivirus membrane protein.
21700358 A role for Tctex-1 (DYNLT1) in controlling primary cilium length
21394082 Data show that Tctex-1 phosphorylated at Thr 94 is recruited to ciliary transition zones before S-phase entry and has a pivotal role in both ciliary disassembly and cell cycle progression.
21262767 Targeted disruption of Tctex-1 by RNA interference significantly impairs bone resorption capacity and mislocalizes Rab3D vesicles in osteoclasts.
21166973 These data show that both DYNLT1 and DYNLT3 interact with L2 of human papillomavirus 16 during virus infection.
20668116 The N-terminal half of pUL35, in particular residues 30-43, was identified as a common region for the binding of DYNLT1 and DYNLT3.
18647839 Tctex-1, a light chain of the molecular motor dynein, is involved in the intracellular targeting of Mason-Pfizer monkey virus (M-PMV) polyproteins to the cytoplasmic assembly site
16956385 Results suggest that the dynein complex disassembles to release cargo due to the specific phosphorylation of Tctex-1 at the S82 residue and that this process is critical for the apical delivery of membrane cargoes.
14583445 We now report that Tctex-1, a light chain of the motor complex dynein, interacts with the cytoplasmic domain of BMPR-II and demonstrate that Tctex-1 is phosphorylated by BMPR-II, a function disrupted by PPH disease causing mutations within exon 12
11751937 Association with Tctex-1 and, hence, with the dynein motor complex may offer an explanation for how poliovirus hijacks the cellular transport machinery to retrogradely ascend along the axon to the neuronal cell body.

AA Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM      1 - 70
QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI                                71 - 113
//

Text Mined References (44)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26792716 2016 Fast track, dynein-dependent nuclear targeting of human immunodeficiency virus Vpr protein; impaired trafficking in a clinical isolate.
26432663 2015 Aberrant Expression of Dynein light chain 1 (DYNLT1) is Associated with Human Male Factor Infertility.
26227614 2015 DYNLT (Tctex-1) forms a tripartite complex with dynein intermediate chain and RagA, hence linking this small GTPase to the dynein motor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944661 2015 Chlamydia trachomatis inclusion membrane protein CT850 interacts with the dynein light chain DYNLT1 (Tctex1).
25928583 2015 A dynein independent role of Tctex-1 at the kinetochore.
24170091 2013 Phosphorylation of DYNLT1 at serine 82 regulates microtubule stability and mitochondrial permeabilization in hypoxia.
23954591 2013 IGF-1 activates a cilium-localized noncanonical G?? signaling pathway that regulates cell-cycle progression.
23840580 2013 Dynein Light Chain 1 (DYNLT1) Interacts with Normal and Oncogenic Nucleoporins.
23006766 2012 The LO-BaFL method and ALS microarray expression analysis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22164227 2011 MAP4 mechanism that stabilizes mitochondrial permeability transition in hypoxia: microtubule enhancement and DYNLT1 interaction with VDAC1.
22028875 2011 Dynein light chain Tctex-type 1 modulates orexin signaling through its interaction with orexin 1 receptor.
21835165 2011 Tumor suppressor REIC/Dkk-3 interacts with the dynein light chain, Tctex-1.
21767858 2011 The interaction of flavivirus M protein with light chain Tctex-1 of human dynein plays a role in late stages of virus replication.
21700358 2011 A role for Tctex-1 (DYNLT1) in controlling primary cilium length.
21394082 2011 Ciliary transition zone activation of phosphorylated Tctex-1 controls ciliary resorption, S-phase entry and fate of neural progenitors.
21269460 2011 Initial characterization of the human central proteome.
21262767 2011 Tctex-1, a novel interaction partner of Rab3D, is required for osteoclastic bone resorption.
21166973 2011 Identification of the dynein light chains required for human papillomavirus infection.
20668116 2010 Identification of binding domains in the herpes simplex virus type 1 small capsid protein pUL35 (VP26).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18647839 2008 D-retrovirus morphogenetic switch driven by the targeting signal accessibility to Tctex-1 of dynein.
17965411 2007 Interaction of the DYNLT (TCTEX1/RP3) light chains and the intermediate chains reveals novel intersubunit regulation during assembly of the dynein complex.
16956385 2006 Regulatory dissociation of Tctex-1 light chain from dynein complex is essential for the apical delivery of rhodopsin.
16880273 2006 Supervillin modulation of focal adhesions involving TRIP6/ZRP-1.
16260502 2005 Cytoplasmic dynein nomenclature.
15992542 2005 The dynein light chain Tctex-1 has a dynein-independent role in actin remodeling during neurite outgrowth.
15503857 2004 Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15194795 2004 Receptor (CD155)-dependent endocytosis of poliovirus and retrograde axonal transport of the endosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583445 2003 Functional interaction between BMPR-II and Tctex-1, a light chain of Dynein, is isoform-specific and disrupted by mutations underlying primary pulmonary hypertension.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12049630 2002 Human tastin, a proline-rich cytoplasmic protein, associates with the microtubular cytoskeleton.
12009301 2002 Voltage-dependent anion-selective channel (VDAC) interacts with the dynein light chain Tctex1 and the heat-shock protein PBP74.
11751937 2002 Interaction of the poliovirus receptor CD155 with the dynein light chain Tctex-1 and its implication for poliovirus pathogenesis.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
9804756 1998 Interaction of Doc2 with tctex-1, a light chain of cytoplasmic dynein. Implication in dynein-dependent vesicle transport.
8943288 1996 The mouse t-complex-encoded protein Tctex-1 is a light chain of brain cytoplasmic dynein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8646886 1996 Cloning, expression, and mapping of TCTEL1, a putative human homologue of murine Tcte1, to 6q.