Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.31
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group B ependymoma 4.600 1.0e-15
group 3 medulloblastoma -1.500 4.5e-03
glioblastoma -1.100 2.8e-02
medulloblastoma, large-cell -2.300 6.4e-06
non-small cell lung cancer -1.328 2.9e-05
pediatric high grade glioma -1.100 2.0e-02
lung adenocarcinoma -1.200 3.5e-03
nasopharyngeal carcinoma -3.400 2.7e-07
Endometriosis -1.278 3.2e-02
ductal carcinoma in situ 1.200 3.5e-02
ovarian cancer -1.300 3.3e-03
Breast cancer -1.200 7.4e-07

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19711352 Findings indicate that km23-2 (DYNLRB2) is required for Smad3-dependent TGFbeta signaling. Km23-2 has functions in TGFbeta signaling that are distinct from those for km23-1 (DYNLRB1).
11750132 Among the total 68 liver cancer samples tested, DNLC2B was down-regulated in 28 cases.

AA Sequence

MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLR      1 - 70
IRSKKHEIMVAPDKEYLLIVIQNPCE                                                 71 - 96
//

Text Mined References (11)

PMID Year Title
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19711352 2009 Requirement of a dynein light chain in TGFbeta/Smad3 signaling.
16260502 2005 Cytoplasmic dynein nomenclature.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077152 2002 The roadblock light chain binds a novel region of the cytoplasmic Dynein intermediate chain.
11750132 2001 Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.