Property Summary

NCBI Gene PubMed Count 29
PubMed Score 168.64
PubTator Score 43.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 2.2e-03
Multiple myeloma 1.037 5.1e-04
osteosarcoma -1.389 3.4e-04
ovarian cancer 2.100 4.0e-06
psoriasis -1.400 9.8e-05

Gene RIF (10)

AA Sequence

MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR      1 - 70
IRSKKNEIMVAPDKDYFLIVIQNPTE                                                 71 - 96
//

Text Mined References (32)

PMID Year Title