Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.98
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (2)

PMID Text
25312846 The DYNLL2 binding region, located in an intrinsically disordered domain of the myo5a tail, has a nascent helical character.
20889982 the thermodynamic and kinetic fine-tuning of binding of various ligands to DYNLL could have physiological relevance in its interaction network.

AA Sequence

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (24)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25312846 2014 DYNLL2 dynein light chain binds to an extended linear motif of myosin 5a tail that has structural plasticity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20889982 2010 Affinity, avidity, and kinetics of target sequence binding to LC8 dynein light chain isoforms.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260502 2005 Cytoplasmic dynein nomenclature.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14561217 2004 Localization of dynein light chains 1 and 2 and their pro-apoptotic ligands.
12591950 2003 JNK phosphorylation of Bim-related members of the Bcl2 family induces Bax-dependent apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097491 2002 Gephyrin interacts with Dynein light chains 1 and 2, components of motor protein complexes.
11546872 2001 Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.
10844022 2000 Interaction of the postsynaptic density-95/guanylate kinase domain-associated protein complex with a light chain of myosin-V and dynein.