Property Summary

NCBI Gene PubMed Count 90
PubMed Score 525.61
PubTator Score 702.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.1e-05
Waldenstrons macroglobulinemia 1.373 1.7e-03
Multiple myeloma 1.161 2.5e-02
Duchenne muscular dystrophy 1.315 6.5e-07
autosomal dominant Emery-Dreifuss muscul... 1.049 1.2e-02
Becker muscular dystrophy 1.107 5.1e-03
juvenile dermatomyositis 1.318 3.8e-09
acute quadriplegic myopathy 1.616 1.2e-05
tuberculosis and treatment for 6 months -1.600 3.2e-03
lung cancer 1.300 1.4e-04
Breast cancer 2.800 2.7e-02
acute myeloid leukemia -1.300 5.0e-02
ovarian cancer 1.900 3.2e-04

 GO Function (1)

Protein-protein Interaction (180)

TTC26   SFI1   DCTN6   PLK4   GOSR2   KIF3C   AURKA   SPTBN2   KIF3B   CEP290   NPHP1   YKT6   CCP110   BCL2L11   SSNA1   USO1   ATG13   NPHP4   HMMR   ULK1   OFD1   DCTN3   HAUS5   CEP152   CCNB2   GOSR1   PCNT   FGFR1OP   INS   SPTA1   TUBB4A   CDK1   TUBB   HSP90AA1   SPTB   CCNB1   FOLR1   PRKACA   RAB6A   TUBG1   KDELR1   PRKAR2B   CETN2   PAFAH1B1   MAPK8   CSNK1D   CSNK1E   TMED10   NEK2   PLK1   RAB8A   RAB11A   TUBA4A   TUBB4B   SPTBN1   GOLGA2   GALNT2   GALNT1   TMEM115   IFT88   STX5   DCTN2   SPTAN1   DCTN1   GOLGB1   IQCB1   PCM1   TMED2   MAPRE1   TCTN1   C2CD3   ODF2   TMEM67   CEP78   KIF24   CEP162   CEP135   RPGRIP1L   HAUS3   TTBK2   TCTN3   BORA   ATG14   TUBA1A   CLASP1   HAUS6   TTC21B   CNTRL   SDCCAG8   CEP57   CEP97   IFT20   AHI1   TTC30B   ARFGAP2   DYNC2H1   PIK3C3   WDR19   CEP70   NEDD1   CEP76   ALMS1   DYNC2LI1   TRAF3IP1   RB1CC1   CEP192   FBF1   DYNLRB2   WDR60   IFT81   GBF1   KIFAP3   CLUAP1   HAUS1   OPTN   TUBGCP3   WDR34   DYNLL2   IFT43   BICD1   TCTN2   AJUBA   MARK4   IFT74   CEP63   SCLT1   RAB3IP   TUBGCP6   TUBGCP5   IFT140   CDK5RAP2   CEP89   PIK3R4   HAUS7   B9D2   GORASP1   ATG101   TUBGCP2   HAUS8   DCTN5   CEP250   TMED9   IFT27   CEP41   AMBRA1   RAB1B   SPTBN4   HAUS4   IFT22   IFT122   CENPJ   DYNLRB1   IFT46   SPTBN5   TUBG2   HAUS2   IFT57   MKS1   NDE1   BET1L   TMEM216   CEP72   IFT80   CC2D2A   WDR35   IFT172   TUBGCP4   DCTN4   TPX2   B9D1   CEP131   CEP164   NINL   IFT52   TMED7   TMED3   KIF3A   HSPB11   CEP83   DYNC1LI1  

Gene RIF (42)

PMID Text
26923072 DLC1 binding to nNOS-calmodulin complex does not affect the electron transport from the reductase to the oxygenase domain.
26652654 NMR-derived secondary chemical shifts and relaxation properties show that the Chica LC8 binding domain is essentially disordered with a dynamically restricted segment in one linker between motifs.
26226419 Studies indicate that dynein light chain LC8 has been termed an intrinsically disordered proteins (IDPs) dimerization 'hub' protein.
26157129 DLC1 binding motif in L is involved in cytoskeleton localization and reorganization, primary transcription regulation by DLC1, and regulation of cellular DLC1 gene expression.
25741013 Authors demonstrate that the interaction between ebola virus VP35 and dynein LC8 is direct and of high affinity and that binding stabilizes the VP35 N-terminal oligomerization domain and enhances viral RNA synthesis.
25568209 Overall, this study demonstrates the novel interaction between HIV-1 integrase and cellular DYNLL1 proteins and suggests the requirement of this virus-cell interaction for proper uncoating and efficient reverse transcription of HIV-1.
25568209 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
25568209 Knockdown of dynein light chain 1 (DYNLL1) by shRNA inhibits HIV-1 replication in C8166T cells
25272277 The dynein light intermediate chain has a Ras-like fold with insertions that distinguish it from Ras and other previously described G proteins.
23589491 Dynein forms distinct complexes requiring specific recruiters and activators to promote orderly progression through mitosis.
23482567 Structural analysis of LC8 with both Nek9 peptides, together with different biophysical experiments, explains the observed diminished binding affinity of Nek9 to LC8 upon phosphorylation on Ser(944) within the Nek9 sequence
23293355 Overexpressed human LC8 inhibits mouse osteoclast differentiation by regulating NF-kappaB & MAPK pathways and suppressing RANKL signaling.
23027904 appropriate levels of ternary complex components are critical for dynein-dependent spindle positioning in HeLa cells and C. elegans embryos
22965910 DYNLL1 interacted with a spindle-microtubule-associated adaptor formed by CHICA and HMMR via TQT motifs in CHICA.
22514732 Study found the secretion of calu-1/2-EGFP required microtubule integrity, and that calu-1/2-EGFP-containing vesicles were transported by the motor proteins Kif5b and cytoplasmic dynein.
22430153 Cytosolic mfGbeta is recruited to dynein by Nudel and transported to the centrosome for rapid sequestration and degradation.
22167198 The ASCIZ-DYNLL1 feedback loop represents a novel mechanism for auto-regulation of gene expression, where the gene product directly inhibits the transcriptional activator while bound at its own promoter.
21971545 these results imply a potential cellular interference between DYNLL1 and ATMIN functions.
21621319 The study uses thermodynamics and dynamics measurements of LC8 complexes to group LC8 binding partners in two categories: those whose binding is enthalpically driven and those that are entropically favored.
21533121 results significantly widen the scope of the human interactome around DYNLL and will certainly shed more light on the biological functions and organizing role of DYNLL in the human and other eukaryotic interactomes
21454704 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
21094642 Data demonstrate the direct interaction between DYNLL1 and peptides derived from ASFV p54 and gephyrin interacting sequences.
20936810 effect of glycosylation on protein folding thermodynamics and kinetics
20889982 the thermodynamic and kinetic fine-tuning of binding of various ligands to DYNLL could have physiological relevance in its interaction network.
20801876 Data provide the first trafficking regulatory role for Crmp2 in non-neuronal cells and support a model in which Crmp2 is an important endocytic regulatory protein that links MICAL-L1.EHD1-based vesicular transport to dynein motors.
20444980 Data suggest that MTOC-directed movement of lytic granules in NK cells is independent of actin and microtubule reorganization, dependent on dynein motor function, occurs before MTOC polarization, and does not require a commitment to cytotoxicity.
20412299 Data identify GRINL1A as a membrane-associated DYNLL1 binding partner and suggest that additional DYNLL1-binding partners are present near this glutamate channel homolog.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19557173 LC8 facilitates nuclear import of Pak1 and this function is indispensable during vertebrate development
19454010 Knockdown of DYNLL1 by shRNA leads to reduced levels of particulate CA in HIV-1-infected cells, suggesting that DYNLL1 plays an important role in CA uncoating
19032974 Hierarchy in guanidine unfolding of DYNLL1 dimer is reported.
18767155 The data indicated the presence of intermediates along the equilibrium unfolding transition; the hydrogen exchange data suggested that the DLC8 molecule has differential stability in its various segments.
18692162 pH dependent unfolding characteristics of DLC8 dimer: Residue level details from NMR.
18579519 LC8 binds IkappaBalpha in a redox-dependent manner and thereby prevents its phosphorylation by IKK. TRP14 contributes to this inhibitory activity by maintaining LC8 in a reduced state.
18084006 findings reveal a previously unrecognized regulatory mechanism of DLC1 in which the Ser(88) phosphorylation acts as a molecular switch for the transition of DLC1 from dimer to monomer
17169380 we established for the first time expression of PIN/LC8 in human mast cells
17012239 dynein light chain 1 represents a novel anchoring protein for RasGRP3 that may regulate subcellular localization of the exchange factor
16781079 PIN not only inhibits nitric oxide but also .O(2)(-) production from nitric oxide synthase 1
16684779 the DLC1-KIBRA interaction is essential for ER transactivation in breast cancer cells
16098226 PAX6 interacts with HOMER3, DNCL1, and TRIM11. Three C-terminal PAX6 mutations, previously identified in patients with eye malformations, all reduced or abolished the interactions.
15611139 LC8 binds to p53-binding protein 1 and mediates DNA damage-induced p53 nuclear accumulation
15504720 the regulation of DLC1 by p21-activated kinase 1 is a novel mechanism by which a signaling kinase might influence macropinocytosis

AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (96)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26923072 2016 The protein inhibitor of nNOS (PIN/DLC1/LC8) binding does not inhibit the NADPH-dependent heme reduction in nNOS, a key step in NO synthesis.
26652654 2016 The Anchored Flexibility Model in LC8 Motif Recognition: Insights from the Chica Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26226419 2015 Multivalent IDP assemblies: Unique properties of LC8-associated, IDP duplex scaffolds.
26157129 2015 A Dynein Light Chain 1 Binding Motif in Rabies Virus Polymerase L Protein Plays a Role in Microtubule Reorganization and Viral Primary Transcription.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25741013 2015 Ebola virus VP35 interaction with dynein LC8 regulates viral RNA synthesis.
25568209 2015 Human immunodeficiency virus type 1 employs the cellular dynein light chain 1 protein for reverse transcription through interaction with its integrase protein.
25416956 2014 A proteome-scale map of the human interactome network.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23589491 2013 Systematic dissection of dynein regulators in mitosis.
23482567 2013 Structural analysis of the regulation of the DYNLL/LC8 binding to Nek9 by phosphorylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23293355 2013 Dynein light chain LC8 inhibits osteoclast differentiation and prevents bone loss in mice.
23027904 2012 Cortical dynein is critical for proper spindle positioning in human cells.
22965910 2012 Dynein light chain 1 and a spindle-associated adaptor promote dynein asymmetry and spindle orientation.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22514732 2012 The intracellular transport and secretion of calumenin-1/2 in living cells.
22430153 2012 Misfolded G? is recruited to cytoplasmic dynein by Nudel for efficient clearance.
22167198 2012 ATM substrate Chk2-interacting Zn2+ finger (ASCIZ) Is a bi-functional transcriptional activator and feedback sensor in the regulation of dynein light chain (DYNLL1) expression.
21971545 2011 LC8 dynein light chain (DYNLL1) binds to the C-terminal domain of ATM-interacting protein (ATMIN/ASCIZ) and regulates its subcellular localization.
21621319 2011 Conformational dynamics promote binding diversity of dynein light chain LC8.
21533121 2011 Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome.
21454704 2011 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
21402792 2011 The astrin-kinastrin/SKAP complex localizes to microtubule plus ends and facilitates chromosome alignment.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21094642 2011 Structural models of DYNLL1 with interacting partners: African swine fever virus protein p54 and postsynaptic scaffolding protein gephyrin.
20936810 2010 Context-dependent effects of asparagine glycosylation on Pin WW folding kinetics and thermodynamics.
20889982 2010 Affinity, avidity, and kinetics of target sequence binding to LC8 dynein light chain isoforms.
20801876 2010 Collapsin response mediator protein-2 (Crmp2) regulates trafficking by linking endocytic regulatory proteins to dynein motors.
20562859 2010 Network organization of the human autophagy system.
20444980 2010 Rapid lytic granule convergence to the MTOC in natural killer cells is dependent on dynein but not cytolytic commitment.
20412299 2010 Structural basis for the interaction between dynein light chain 1 and the glutamate channel homolog GRINL1A.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20133940 2010 Nucleoporin translocated promoter region (Tpr) associates with dynein complex, preventing chromosome lagging formation during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19557173 2009 Interaction with LC8 is required for Pak1 nuclear import and is indispensable for zebrafish development.
19032974 2009 Hierarchy in guanidine unfolding of DLC8 dimer: regulatory functional implications.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18767155 2009 Residue-wise conformational stability of DLC8 dimer from native-state hydrogen exchange.
18692162 2008 pH dependent unfolding characteristics of DLC8 dimer: Residue level details from NMR.
18650427 2008 Biochemical and structural characterization of the Pak1-LC8 interaction.
18579519 2008 Dynein light chain LC8 negatively regulates NF-kappaB through the redox-dependent interaction with IkappaBalpha.
18420585 2008 RACK1 and CIS mediate the degradation of BimEL in cancer cells.
18084006 2008 Serine 88 phosphorylation of the 8-kDa dynein light chain 1 is a molecular switch for its dimerization status and functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17169380 2007 Regulation and function of the protein inhibitor of nitric oxide synthase (PIN)/dynein light chain 8 (LC8) in a human mast cell line.
17012239 2006 The exchange factor and diacylglycerol receptor RasGRP3 interacts with dynein light chain 1 through its C-terminal domain.
16781079 2006 PIN inhibits nitric oxide and superoxide production from purified neuronal nitric oxide synthase.
16684779 2006 Essential role of KIBRA in co-activator function of dynein light chain 1 in mammalian cells.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16341674 2005 Transcriptome analysis of human gastric cancer.
16260502 2005 Cytoplasmic dynein nomenclature.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16098226 2005 A screen for proteins that interact with PAX6: C-terminal mutations disrupt interaction with HOMER3, DNCL1 and TRIM11.
15891768 2005 Functional regulation of oestrogen receptor pathway by the dynein light chain 1.
15611139 2005 The 8-kDa dynein light chain binds to p53-binding protein 1 and mediates DNA damage-induced p53 nuclear accumulation.
15560738 Alterations in mitochondrial and apoptosis-regulating gene expression in photodynamic therapy-resistant variants of HT29 colon carcinoma cells.
15504720 2005 Dynein light chain 1 phosphorylation controls macropinocytosis.
15193260 2004 Dynein light chain 1, a p21-activated kinase 1-interacting substrate, promotes cancerous phenotypes.
14764673 2004 B cell receptor-mediated apoptosis of human lymphocytes is associated with a new regulatory pathway of Bim isoform expression.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14607844 2004 Identification and characterization of TRP14, a thioredoxin-related protein of 14 kDa. New insights into the specificity of thioredoxin function.
14607843 2004 Roles of TRP14, a thioredoxin-related protein in tumor necrosis factor-alpha signaling pathways.
14561217 2004 Localization of dynein light chains 1 and 2 and their pro-apoptotic ligands.
12857789 2003 Targeting of incoming retroviral Gag to the centrosome involves a direct interaction with the dynein light chain 8.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12761050 2003 Nuclear interaction of the dynein light chain LC8a with the TRPS1 transcription factor suppresses the transcriptional repression activity of TRPS1.
12591950 2003 JNK phosphorylation of Bim-related members of the Bcl2 family induces Bax-dependent apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12097491 2002 Gephyrin interacts with Dynein light chains 1 and 2, components of motor protein complexes.
11978406 2002 Protein inhibitor of neuronal nitric oxide synthase interacts with protein kinase A inhibitors.
11243854 2001 The small GTPase Rab4A interacts with the central region of cytoplasmic dynein light intermediate chain-1.
11178896 2001 Structural basis of diverse sequence-dependent target recognition by the 8 kDa dynein light chain.
11157096 2001 Association of Trk neurotrophin receptors with components of the cytoplasmic dynein motor.
11148209 2001 The 8-kDa dynein light chain binds to its targets via a conserved (K/R)XTQT motif.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11069771 2000 Dynein light chain interacts with NRF-1 and EWG, structurally and functionally related transcription factors from humans and drosophila.
10844022 2000 Interaction of the postsynaptic density-95/guanylate kinase domain-associated protein complex with a light chain of myosin-V and dynein.
10683380 2000 Dynein light chain binding to a 3'-untranslated sequence mediates parathyroid hormone mRNA association with microtubules.
10426949 1999 Structure of the PIN/LC8 dimer with a bound peptide.
10198631 1999 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex.
9837926 1998 Protein inhibitor of neuronal nitric-oxide synthase, PIN, binds to a 17-amino acid residue fragment of the enzyme.
9808772 1998 Binding of dynein light chain (PIN) to neuronal nitric oxide synthase in the absence of inhibition.
9808041 1998 Solution structure of a protein inhibitor of neuronal nitric oxide synthase.
9372968 1997 I kappaB alpha physically interacts with a cytoskeleton-associated protein through its signal response domain.
8864115 1996 PIN: an associated protein inhibitor of neuronal nitric oxide synthase.
8628263 1996 Cytoplasmic dynein (ddlc1) mutations cause morphogenetic defects and apoptotic cell death in Drosophila melanogaster.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.